KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c15020Help
Entry
PGA1_c15020       CDS       T02192                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pga00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:pga00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561494..1562267
Genome map
AA seq 257 aa AA seqDB search
MTLSGKCAVITGSNSGIGLGVAREMARAGADVVLNSFTDRDEDHALAAEIAAEFGVEARY
IQADMSDAEACRALITTSGRCDILINNAGIQHVAPVDEFPVDKWNAILAINLSSAFHTAA
AALPMMRGAGWGRVINIASAHGLTASPYKSAYVAAKHGVVGLTKTLALETAEEPITANAI
CPGYVLTPLVEAQIPDTMEKYNMGREEVIKKVMLERQPSREFATVEQLGGTAVFLCSDAA
AQMTGTTLSVDGGWTAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgagcggcaaatgtgcggtgattaccgggtcgaattccggtattggtcttggg
gttgcgcgggagatggcgcgtgccggggcggatgtggttctgaactcctttaccgaccgt
gacgaggaccatgcgctggccgccgagatcgctgccgagttcggcgttgaggcgcgttat
attcaggcagatatgtccgatgcagaggcctgtcgcgccctgatcaccacatccggtcgc
tgcgacatcctgatcaataatgcagggatccagcatgtggcgccagtggatgagtttccg
gtcgacaagtggaacgcaatccttgctatcaacctgtcgtcagcctttcacaccgccgct
gcggccctgccgatgatgcgcggcgcaggctggggccgggtgatcaatatcgcttcggcg
catggtttgacggcgtccccttacaaatcggcctatgtcgccgccaaacatggcgttgtc
ggtttgaccaagacgctggccctggaaaccgcagaggagccgatcaccgccaatgcgatc
tgtccgggttatgtgctgaccccgctggtggaggcgcagatccccgacacgatggaaaaa
tacaatatgggccgggaagaggtgatcaagaaggtgatgctggagcgccagccctcgcgc
gagtttgcaacggtcgaacaattgggcggcacggcggtgtttctgtgttccgatgcggcg
gcacagatgacaggcaccaccctgagcgtcgatggtggctggaccgcgctgtag

DBGET integrated database retrieval system