KEGG   Phaeobacter inhibens: PGA1_c15020Help
Entry
PGA1_c15020       CDS       T02192                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase BdhA (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pga  Phaeobacter inhibens
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PGA1_c15020 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PGA1_c15020 (bdhA)
Enzymes [BR:pga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PGA1_c15020 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1561494..1562267
Genome map
AA seq 257 aa AA seqDB search
MTLSGKCAVITGSNSGIGLGVAREMARAGADVVLNSFTDRDEDHALAAEIAAEFGVEARY
IQADMSDAEACRALITTSGRCDILINNAGIQHVAPVDEFPVDKWNAILAINLSSAFHTAA
AALPMMRGAGWGRVINIASAHGLTASPYKSAYVAAKHGVVGLTKTLALETAEEPITANAI
CPGYVLTPLVEAQIPDTMEKYNMGREEVIKKVMLERQPSREFATVEQLGGTAVFLCSDAA
AQMTGTTLSVDGGWTAL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgagcggcaaatgtgcggtgattaccgggtcgaattccggtattggtcttggg
gttgcgcgggagatggcgcgtgccggggcggatgtggttctgaactcctttaccgaccgt
gacgaggaccatgcgctggccgccgagatcgctgccgagttcggcgttgaggcgcgttat
attcaggcagatatgtccgatgcagaggcctgtcgcgccctgatcaccacatccggtcgc
tgcgacatcctgatcaataatgcagggatccagcatgtggcgccagtggatgagtttccg
gtcgacaagtggaacgcaatccttgctatcaacctgtcgtcagcctttcacaccgccgct
gcggccctgccgatgatgcgcggcgcaggctggggccgggtgatcaatatcgcttcggcg
catggtttgacggcgtccccttacaaatcggcctatgtcgccgccaaacatggcgttgtc
ggtttgaccaagacgctggccctggaaaccgcagaggagccgatcaccgccaatgcgatc
tgtccgggttatgtgctgaccccgctggtggaggcgcagatccccgacacgatggaaaaa
tacaatatgggccgggaagaggtgatcaagaaggtgatgctggagcgccagccctcgcgc
gagtttgcaacggtcgaacaattgggcggcacggcggtgtttctgtgttccgatgcggcg
gcacagatgacaggcaccaccctgagcgtcgatggtggctggaccgcgctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system