KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c15510Help
Entry
PGA1_c15510       CDS       T02192                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pga00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613221..1614327
Genome map
AA seq 368 aa AA seqDB search
MATLTDAQRIVVKIGSALLVDRTSGALRADWLRALAADVAWLKSMGKDVILVSSGSIALG
RRVLGLAAQELPLEQSQAAAAVGQIRLAGAYEEALAPHEITTAQVLVTLEDSADRRRYLN
SRATLETLIGLGVVPIVNENDTIATDEIRYGDNDRLAAQVAVTVGADALILLSDVDGFYT
ANPVLDPTARRYDIIDRITPEIEAMAGDGVSGLSKGGMITKLLAAKMATAAGCAMAITEG
SPNNPLKLLENGAPSTWFTAQDDPQVARKRWIAAMKTRGVVAVDEGAARALGSGKSLLPA
GIRHIEGDFGRGDPLAILGPDGRKLGQGLSRYTAEEASAIKGCQSTEIEAILGYAGRAAV
IHRDDMAL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccctgaccgacgcccagcgtatcgttgttaaaatcgggtccgcccttttggtg
gaccggacaagcggtgcattgcgggcggattggttgcgggccttggcggcggatgtcgcc
tggttgaaatccatgggcaaggatgtgatccttgtctcatccggctctatcgcgttgggc
cgtcgggtgctggggctggcggcacaggagctgccgttggaacagtcacaggcagcggcg
gccgtcggtcaaatccggcttgcaggcgcttatgaggaggcgctcgccccgcatgagatc
accaccgcacaggtgctggtcacattggaagacagcgcggatcgacgtcgctatctgaat
tcccgcgccacattggagactctcattggccttggcgttgtgcccatcgtcaatgaaaac
gacaccatcgccacagatgaaatccgctatggtgataacgatcggctggcggcgcaggtg
gcggtgacggttggcgcggatgcgcttattctgctgtcggatgttgatgggttctacacc
gccaaccctgtgttggatccgacggcccggcgctatgacatcattgaccggattacgccc
gagatcgaggcaatggcgggggacggtgtctcaggcctttccaaaggtggtatgatcacc
aaattgctggcggccaaaatggcgacggcggcgggctgcgctatggccatcaccgaaggt
tcgcccaataatccattgaagttgcttgaaaatggcgcgccttccacgtggttcaccgcg
caggatgatccgcaggttgcgcgcaagcgctggatcgcggcaatgaagacgcgcggtgtg
gtcgctgtggatgaaggcgcagcacgggcgctcggctccggcaaaagccttttgccagct
ggcatccgacatatcgaaggagactttggccgcggtgacccgctggccatcctgggtcca
gacgggagaaaactggggcaggggctcagccggtatacggctgaagaggcttctgccatc
aaagggtgccagtcgaccgagatcgaggcaatccttggctatgcaggccgcgcggctgtc
atccaccgtgatgatatggcgctgtag

DBGET integrated database retrieval system