KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c16250Help
Entry
PGA1_c16250       CDS       T02192                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pga00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1686968..1687639
Genome map
AA seq 223 aa AA seqDB search
MTKPAPDDSDTLRQSIIDACLEMNRSGINQGTSGNISLRIAGGEMLITPSGIPYEAMSPD
MIVRMPVVGSPDPQRGQPSPSSEWQFHQALLEDKPEVMAVVHAHPVNCCALAVNHMPIPA
CHYMVAAFGGHDVPLAEYALFGTTELSAHVVAAMADREGCLMANHGAICTGDTLARAMWR
MAELEHLAATYIRARSIGTPRLLSSAQMDEALAAFASYGLKQD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacctgccccggatgacagcgacacactgcgccagtcgattattgacgcctgt
ctggagatgaaccggagtggcattaatcagggcacctcaggcaatatctcgctgcggatc
gccgggggggagatgctgatcaccccatccggcatcccctatgaggcgatgagcccggac
atgattgtccggatgcccgtggtcggcagcccagatccgcagagggggcagccttccccc
tcttccgagtggcaatttcatcaggcactgctcgaagacaagccagaggtgatggccgtc
gtccatgcccacccggtgaactgctgtgccctcgctgtgaaccacatgcctatcccggcc
tgccactatatggtggcagcatttggcgggcatgacgtgccactggcagaatatgcgctg
ttcggcacgaccgaattatcagcccatgtggttgcggcaatggcggaccgcgaggggtgc
ctgatggcgaaccatggcgccatctgcacaggcgacacactggcgcgcgccatgtggcgg
atggccgagctggagcatttggcggcaacttatattcgcgcgcgcagcattggcacgcca
aggctgcttagctcggcgcagatggacgaggcgctggcagcgtttgcgagctatggcttg
aaacaggattga

DBGET integrated database retrieval system