KEGG   Phaeobacter inhibens DSM 17395: PGA1_c16370Help
Entry
PGA1_c16370       CDS       T02192                                 

Gene name
arcA
Definition
(GenBank) arginase ArcA
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00220  Arginine biosynthesis
pga00330  Arginine and proline metabolism
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01130  Biosynthesis of antibiotics
pga01230  Biosynthesis of amino acids
Module
pga_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PGA1_c16370 (arcA)
   00330 Arginine and proline metabolism
    PGA1_c16370 (arcA)
Enzymes [BR:pga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PGA1_c16370 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFO91341
UniProt: I7DQL0
Position
1697965..1698897
Genome map
AA seq 310 aa AA seqDB search
MRVTSKTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEP
DTNDGLVFARNETIGWTNRLIRAAEEAMKDGLPIFLGGDHSLSLGSVVGVANHAAKEGRP
QFVLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSV
DTPERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPA
VGTTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRR
VFDRPTRSYQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacatccaagacctgtattctgatcggcgccccggtggacagcggcaagcga
cgcgccggatgcctgatggggccggatgcctatcgcaccgccggtctggggcgcgcaatt
gaaagtctgggtcataaggtgatcgatcagggcaatctgcgtcccgccacccatgaaccc
gataccaacgacggtctggtctttgcccgcaatgaaacgatcggctggaccaatcgcctg
atccgcgccgccgaagaggcgatgaaagatggcctgccgatcttccttggtggcgaccat
tcgctgtccttggggtcggttgttggcgtggccaaccacgcggccaaggaaggccgcccg
caattcgtgctgtggcttgatgcgcataccgattttcacaccccggccacctccgacagc
ggcaacctgcacggcacaccagtgggctatttcaccgggcgtccggattttgcaggcttt
cccgaggtggccaatccggtcccgcaggaaaatgtctgcatgatcggcctgcgctcggtt
gataccccggaacgcctcgcgcttgaggccagcgatattcaccgtcatgacatgcgtgat
atcgacgaaaatggcattgccggcccgctttctgccttccttcagcgggtcaaggatgcc
aacggaatgctgcatgtttcgctggatgttgattttctggacccgtctgtggcccctgcg
gtcggcaccaccgtgcccggcggcgccacagtgcgcgaggggcatctggtgtgcgaaatg
ctgcatgattccgggctgatgacctctttggatctggtagaactgaacccgtttctggat
gagcgcggccgcacggcccatctgatggtggatctctgcgcctcggcccttgggcgtcgt
gtctttgaccgcccgacacggagctatcaatga

DBGET integrated database retrieval system