KEGG   Phaeobacter inhibens: PGA1_c16370Help
Entry
PGA1_c16370       CDS       T02192                                 

Gene name
arcA
Definition
arginase ArcA (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pga  Phaeobacter inhibens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGA1_c16370 (arcA)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGA1_c16370 (arcA)
Enzymes [BR:pga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PGA1_c16370 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697965..1698897
Genome map
AA seq 310 aa AA seqDB search
MRVTSKTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEP
DTNDGLVFARNETIGWTNRLIRAAEEAMKDGLPIFLGGDHSLSLGSVVGVANHAAKEGRP
QFVLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSV
DTPERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPA
VGTTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRR
VFDRPTRSYQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacatccaagacctgtattctgatcggcgccccggtggacagcggcaagcga
cgcgccggatgcctgatggggccggatgcctatcgcaccgccggtctggggcgcgcaatt
gaaagtctgggtcataaggtgatcgatcagggcaatctgcgtcccgccacccatgaaccc
gataccaacgacggtctggtctttgcccgcaatgaaacgatcggctggaccaatcgcctg
atccgcgccgccgaagaggcgatgaaagatggcctgccgatcttccttggtggcgaccat
tcgctgtccttggggtcggttgttggcgtggccaaccacgcggccaaggaaggccgcccg
caattcgtgctgtggcttgatgcgcataccgattttcacaccccggccacctccgacagc
ggcaacctgcacggcacaccagtgggctatttcaccgggcgtccggattttgcaggcttt
cccgaggtggccaatccggtcccgcaggaaaatgtctgcatgatcggcctgcgctcggtt
gataccccggaacgcctcgcgcttgaggccagcgatattcaccgtcatgacatgcgtgat
atcgacgaaaatggcattgccggcccgctttctgccttccttcagcgggtcaaggatgcc
aacggaatgctgcatgtttcgctggatgttgattttctggacccgtctgtggcccctgcg
gtcggcaccaccgtgcccggcggcgccacagtgcgcgaggggcatctggtgtgcgaaatg
ctgcatgattccgggctgatgacctctttggatctggtagaactgaacccgtttctggat
gagcgcggccgcacggcccatctgatggtggatctctgcgcctcggcccttgggcgtcgt
gtctttgaccgcccgacacggagctatcaatga

DBGET integrated database retrieval system