KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c16580Help
Entry
PGA1_c16580       CDS       T02192                                 

Definition
CheR and CheB-like domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pga02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pga02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1720377..1723628
Genome map
AA seq 1083 aa AA seqDB search
MTTQTTQDLTIIGIGSSAGGLEAIRELVATLPVDVPAAYVVVQHMSPHHKSLMTELVARQ
TQLKVGTIQNGTIPEANVVYITPPKSDVIFSDGRLHLLQDPNAEPGTPRPSVDRFLVSLA
EQNGDNSMAIILSGTGSDGAYGVQAIREAGGITIAQDAESAKYDGMPVAAVQTGCVDLVL
RPQDIGANLQKILSSPRDFTSFRHENSLRDSPVSDLLQILLARTRVDFRDYKQTTISRRI
ERRMIALGIETQEEYTQFCRNNPHAVDALFKDLLISVTRFFRDREEFELLKALLPQLIKE
RGPGPLRIWVAGCATGEEAYSIAMVVSEALGNPTNQLKSRVQIFATDIDKDALKTARKGV
YSLAALNDIPSELADKYLIRQTDGVRVVDNLRNAVLFSDHNVCQDPPFQKVDLICCRNLL
IYFGNPLQQKVMSRFHYAMSPHGLLFLGTAESVAGSDELFVQDRSASHVYRKRSLRAHQA
QQPYNMPSVPMMAQRPTIKPPAQPGPSTDRQLFEALAQSLGKNSLLVTEDFSIARVYGSV
SQFIEVNETSSLRMHLDLLRSPLREEARSLITIALKNGAHKGGVRHLLAENDDEEIRLDV
YPIIAKDISERAALVVFTPVTVDRSRMNEAPIVGEEGDATFERIRNLENEVATTREALQQ
TIEELETSNEELQSLNEELQSTNEELQATNEELETSNEELQSTNEELITVNEELQVTASE
LSGRTGELISVLESTPLAIVVADSALQITQATLAATRMFNIRRPISSPHISQCALPEGFP
ILAPICSEALRLGQTVTEEFTSKGTRIRLTCSPYFDVNGQILGVTMVVSEFPGMAHEMEM
ILDNSNLLLLNRTRSGEILRISSAYAELLGLSRDKALSKNLFALASDAGADEQMLREDAK
VLDSKDGFDNELLQVSLPGGEGDRWISMDRHRFPHHITEEPTVFTIGTDVTETVEARERA
EELLMQAELVQDMVGIGFWSIDADGQTPYWSPKVYEIHGVKPEDYDPEIDSAIAFFHPDD
REDVQRIVSEAIETGNGFSFIKRLIRPDGVEIQVESQGMAIRDDNGDVTRLVGIFREAQE
TDS
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaaacaactcaggacctgaccattatcggcatcgggtcttccgcaggcgga
cttgaagccattcgtgagctggttgcgacgctcccggtggatgtgcctgcggcctatgtt
gttgtccaacatatgtcgccacaccacaaaagcctgatgacggagctggtggcgcggcag
acccagctgaaggtcggcaccatacaaaatggcacgatccccgaggccaatgtcgtctat
atcaccccgcccaagagcgatgtcatcttctcagatggtcgcctgcacctgttgcaggat
cccaatgccgaacccggtacgccgcgcccctcggtcgaccgcttcctggtcagccttgcg
gagcagaacggcgacaactccatggcgatcatcctttcggggaccggcagtgatggcgcc
tatggcgtacaggccatccgagaggccggcggcattaccattgcgcaggacgccgaaagc
gcgaaatacgatggaatgcctgtagctgcggtgcagaccggctgcgtcgatctcgtgctg
cggccgcaagatatcggcgccaacctgcagaagatcctctcttccccacgtgatttcacc
tccttccggcatgagaacagcctgcgggactcgccggtgtcggatctgctacaaattctt
ctggcgcgcacccgcgtggatttccgcgactacaaacagacaaccatcagccgccggatc
gagcggcgcatgattgcccttgggatcgaaacccaggaggaatacacccagttctgccgc
aacaaccctcatgctgttgatgccttgttcaaggacttgctgatttcggtcacgcggttt
ttccgcgaccgcgaagaattcgagttgttgaaagcgctgctgccccaactgatcaaggag
cgcggtcccggcccgctgcgaatctgggtggctggctgcgccaccggcgaagaggcctac
tcaatcgccatggtggtctctgaggcgctcggcaacccgaccaatcagctcaaatcacgg
gtgcagattttcgcgaccgatatcgataaggatgcgttgaaaacggcgcgtaaaggggtc
tacagccttgcggcgctgaacgatatcccctctgaacttgcggataaatacctgatccgc
cagaccgatggcgtccgggtggtcgacaacctgcgcaatgcggttctgttctctgaccac
aacgtttgccaggatccgccatttcagaaggtcgatctgatctgttgccgcaacctgctg
atttatttcggcaacccactgcagcagaaggttatgtcgcggttccactatgcgatgtca
ccacatggtttgctgttcctcggcaccgccgagagcgtcgccggatcggatgagttgttc
gtccaggaccgctccgcatcccatgtctaccgcaagcgatccctgcgcgcccatcaggcc
cagcagccctataatatgccatcggtgccgatgatggcgcagcggccaaccatcaaaccg
cctgcacagccggggccctccaccgaccgtcagctgtttgaggcattggcacagtccctg
ggcaaaaactcgcttctggtcaccgaggatttctccatcgcgcgggtctatggctcggtc
agtcagtttattgaggtcaatgagaccagttcgctgcggatgcatcttgatctgctgcgc
agccccctgcgcgaagaggcccgcagcctgattaccatcgcgttgaaaaacggggcccat
aagggcggcgtacgccacctgctggcagagaatgatgacgaggagattcgtctcgacgtc
tacccaattatcgccaaagacatcagcgaacgcgccgcgctggtggtcttcacgccggtc
acggttgaccggtcccggatgaatgaggcaccgattgtaggcgaagaaggcgacgctacc
tttgagcggatccgcaacctggagaatgaggtcgcaaccacccgcgaagcgctgcagcag
accattgaagagctggaaacctccaatgaggaactgcagtcgctcaatgaggaactgcaa
tccaccaacgaggagctgcaagccaccaatgaagagctggaaacctccaacgaggaactg
caatccaccaacgaagagctgattaccgtcaacgaggaactgcaggtcaccgcatccgag
ctgagtggtcgtaccggcgagctgatttccgttctggaaagcacgccactggcgattgtt
gtggccgacagcgctttgcagatcactcaggcaactctggcggcaacccggatgttcaat
atccgccgcccgatttccagcccgcacatcagccaatgcgcgctgcccgaagggtttccg
attctggcgccgatttgcagcgaggccctgcgtcttggccagactgtgaccgaggaattc
acctccaagggcacccgcatccgcctgacctgctcgccctatttcgatgtcaacgggcag
atccttggcgtgaccatggtggtgtcggaattccccggcatggcccatgagatggagatg
atcctcgacaactccaatctgctgctgctcaatcgaacccgcagtggtgagatcctgcgg
atcagttcggcctatgcggaactccttggtctgagccgggacaaggcgctgtcaaagaac
ctctttgcactcgcatcggacgccggcgctgatgagcagatgctccgggaagatgcaaag
gtgctcgacagcaaggacgggtttgacaatgaactgctgcaggtgagcttgcccggtggt
gagggcgaccgctggatcagcatggaccgccaccggttcccgcatcacatcaccgaggaa
ccgactgttttcaccattggcaccgatgtgacagaaaccgtggaggcacgcgaacgggcc
gaagagctgctgatgcaggccgaattggttcaggacatggtcgggatcggtttctggtcc
atcgatgcggatggccagaccccctattggtcgcccaaggtctatgagatccatggcgta
aaacccgaggattatgatccggaaatcgacagcgcgattgccttcttccaccccgatgac
cgtgaggatgtgcagcgcatcgtctccgaggccattgaaacgggtaacggtttttccttc
atcaaacgtttgatccgtcccgatggcgtcgagatccaggtggagagccaggggatggct
attcgcgacgacaatggtgatgtgacgcgactggtcgggatcttccgcgaggcgcaggag
actgacagctga

DBGET integrated database retrieval system