KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c16910Help
Entry
PGA1_c16910       CDS       T02192                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase TrpC (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pga01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pga00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1765329..1766141
Genome map
AA seq 270 aa AA seqDB search
MTETVLDKIKAYKLEEIAADKAAKPLEAVEAEARDASPVRGFAKALMQASRDGYGLIAEI
KKASPSKGLIREDFHPADLARAYEAGGATCLSVLTDTPSFQGAKSFLTEAREACALPALR
KDFMYDPYQVAEARALGADCILIILASVSDTQAAELEAAAADWNMDVLLEVHDEEELHRA
CKLTSPLLGINNRNLKTFETTLDTTRTLSRLVPADRTIVCESALSTPADLSDMARYGARS
FLIGESLMRQDDVAAATRDILANPLMPGAM
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacagtgctggacaagatcaaggcctacaagctggaagagatcgccgccgac
aaggcagccaaacccctcgaagcggttgaggccgaagcccgtgatgccagcccggtgcgt
ggctttgccaaggcgctgatgcaggccagccgcgatggctacgggctgattgccgaaatc
aagaaagccagcccttccaaagggttgatccgggaagattttcaccccgcagacctcgcc
cgggcctatgaggccggtggtgcaacctgcctttccgtgctgaccgatactcccagtttt
cagggcgcgaaatcctttctgaccgaggcgcgcgaggcctgtgccctcccggccctgcgc
aaggatttcatgtatgatccctatcaggtggctgaggcgcgcgcgcttggtgctgactgt
atcctgatcattctcgcctctgtctccgacacgcaggcagcagagctggaagccgccgcc
gctgattggaatatggacgtgctgctggaggttcatgacgaggaagagttgcatcgcgcc
tgcaagctgacatcgcctcttcttggcatcaacaaccgcaatctcaaaacctttgagacc
acattggacaccacccgcaccctgtcccgtctggttcccgccgatcggaccattgtctgc
gaaagcgcgctgtccacgcctgcggatctctctgatatggcccgctatggcgcgcgtagt
ttcctcatcggtgaaagcctgatgcgccaggatgacgtcgccgccgcgacccgtgatatt
cttgctaacccgctgatgccgggggcaatgtga

DBGET integrated database retrieval system