KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c19920Help
Entry
PGA1_c19920       CDS       T02192                                 

Gene name
speB1
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pga00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2066670..2067617)
Genome map
AA seq 315 aa AA seqDB search
MTDFNQPISGNDLARFSGPNTFMRLPQATSLDGLDVAILGVPMDIGTSWRSGTRFGPKQI
RAESAMIRPYNMTSGAAPFDSLNIGDIGDLAINTFSLPDSLRIIQESYSAILASDVTPVA
MGGDHSITLPILRAVAEKYGPVALVHVDAHADVNDDMFGERETHGTVFRRAYEEGLIVAD
KTYQIGLRGTGYGADDFKEAQRWGFQHFPASELWNRSLHGMGAEIRRDIGNRPVYVSYDI
DSLDPAYAPGTGTPEIGGLTTPQALELIRALRGLNIVGCDMVEVSPPYDTSGNTALTAAN
LLYELLCVLPGVTTK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttcaatcaaccgatcagcggcaatgatctggcacggttttccggtccgaac
accttcatgcggctgccacaggccacctcgctggacgggctggacgtagccattctgggc
gtgccgatggatatcggcacctcctggcgctctggcacccgctttggccccaagcagatc
cgcgccgaaagcgcgatgatccgcccctacaatatgacctctggcgcggcgccgttcgac
agcctgaacattggcgatatcggcgatctggcgatcaatacgttctctctgcccgacagc
ttgcgcatcatccaggaaagctacagcgccattctggccagtgacgtgaccccggttgcg
atgggcggcgaccattcgattaccctgccgatcctgcgcgccgttgccgaaaaatacggc
cccgtcgccttggtccatgtcgatgcccatgcggatgtgaacgacgatatgttcggcgag
cgcgaaacccatggcaccgtgttccgtcgcgcctatgaggagggtctgattgtcgccgac
aagacctaccagatcgggcttcgtggcaccggctacggcgccgatgatttcaaggaagcg
cagcgctggggcttccagcatttcccagccagcgaattgtggaaccgctccctgcacggc
atgggtgcggaaattcgtcgcgatatcggcaataggccggtctatgtttcctatgatatt
gatagtcttgacccggcttatgcgccgggcaccggcacgccggaaatcggcgggctgaca
acgccgcaggcactggagttgatccgggccttgcgggggctgaacattgtgggttgcgac
atggtcgaagtgtcgccgccttatgacacatcgggcaatacggcgctgacagcggccaac
ctgctgtatgagctgctctgtgtgctgccgggggtgacaacaaaataa

DBGET integrated database retrieval system