KEGG   Phaeobacter inhibens: PGA1_c19930Help
Entry
PGA1_c19930       CDS       T02192                                 

Gene name
speB2
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pga  Phaeobacter inhibens
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PGA1_c19930 (speB2)
Enzymes [BR:pga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PGA1_c19930 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2067610..2068578)
Genome map
AA seq 322 aa AA seqDB search
MALEDAKHMIDHAFTREDMKGLSFEITFGGATSFLRRKYTKDLTGVDIAVTGVPFDQAVT
NRPGTRLGPRAIREASCLQSPDEPYGWPHKPLSTLAIADYGDLAFDHADVPAFPAALTDH
IRGILATETASVVLGGDHYISFPILKAYAEKHGPISLLQFDAHTDTWPDDNMDRIDHGTM
FYKAVKMGLVDPKTSVQVGIRTTNDDTLGVNIIDAPTVHDIGPVETAKRIKAILGDRPTY
LTFDIDCLDPAYAPGTGTPVWGGLTSAQASRILREIAGINIKGGDVVEVSPPFDTTGATA
IAGAHVATEIICLLGWNMRDND
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgctagaagacgcaaagcacatgatcgatcacgcctttacgcgtgaggatatgaaa
ggtctcagctttgagatcacctttggtggagcgacctcctttctgcgacgcaaatatacc
aaggatctgaccggggtggatatcgcggtcacgggcgtgccgtttgatcaggcggtcacc
aaccggcccggaacacggctgggtccccgcgccatccgcgaggcgtcttgcttgcaaagc
ccggacgaaccctatggctggccacataaaccgctgagcacgctggccattgccgattat
ggtgatctggctttcgatcacgcggatgttccggcatttccggcggcgttgacggatcat
attcgcggtattctggcgaccgagacggcctcggtcgtcttgggtggggatcattatatc
agctttccgatccttaaggcctatgccgagaaacacggcccgatctcgctgttgcagttt
gatgcccataccgacacctggcccgacgacaatatggaccggatcgaccatgggaccatg
ttctacaaggccgtgaaaatgggtctcgtggatccgaaaacatccgttcaggtcgggatc
cgcaccaccaatgacgacacgctgggtgtgaacatcatcgacgcgccgaccgtgcatgac
atcggcccggttgagaccgcgaaacggatcaaggcgatccttggcgaccggccgacctat
ctgaccttcgatatcgactgtctcgatccggcctatgcgccgggcaccggcacaccggtt
tggggtgggctgacctcggcgcaggcgtcgcgcatcctgcgcgagattgcaggcatcaat
atcaaaggcggcgacgtggtggaggtttcccctccgtttgacaccaccggcgccaccgcc
atcgcaggcgcccatgtggcgaccgaaattatctgccttcttggctggaatatgagagac
aatgactga

DBGET integrated database retrieval system