KEGG   Phaeobacter inhibens: PGA1_c20650Help
Entry
PGA1_c20650       CDS       T02192                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pga  Phaeobacter inhibens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA1_c20650 (tpiA)
   01230 Biosynthesis of amino acids
    PGA1_c20650 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c20650 (tpiA)
   00051 Fructose and mannose metabolism
    PGA1_c20650 (tpiA)
   00562 Inositol phosphate metabolism
    PGA1_c20650 (tpiA)
Enzymes [BR:pga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PGA1_c20650 (tpiA)
Exosome [BR:pga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PGA1_c20650 (tpiA)
  Exosomal proteins of bladder cancer cells
   PGA1_c20650 (tpiA)
  Exosomal proteins of melanoma cells
   PGA1_c20650 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2140103..2140855
Genome map
AA seq 250 aa AA seqDB search
MRRKLAAGNWKMNGTASALTELGNLAYSCKSAKAEVLICPPATLLYRAANVCVDSKVSIG
AQDCHDATYGAHTGDLSAEMLHDAGATAVILGHSERRADHDETDETVRAKAKTAIAAGLT
AIICVGETLNDREAGKTLDVVRAQLAGSLPDDASGTTVVVAYEPVWAIGTGKVPTVEQIA
EVHNDMRASLVKRFGGETANAIRLLYGGSVKASNAKEIFAVAHVDGALVGGASLKAADFA
PIVAALDASA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggaaactggccgcaggcaattggaaaatgaacggcaccgcaagtgcgctgaca
gagctgggcaatcttgcctatagctgcaaatccgccaaggccgaggtgctgatctgcccg
cctgcaaccctgctctaccgcgcggccaatgtctgcgtcgacagcaaggtgagcattggc
gcccaggattgccacgacgccacctatggcgcccataccggcgatctcagcgcggaaatg
ctgcatgatgcgggcgccaccgccgtgatcctcggccattccgaacgccgggccgaccac
gatgagacggatgaaacagtccgggccaaggccaagaccgccatcgctgcggggctgacc
gccatcatctgcgtgggcgaaaccctgaacgaccgcgaggcgggcaaaacacttgatgtg
gtccgggcccaattggcaggctccctccccgatgacgccagcggcacaaccgtggtggtg
gcctacgaaccggtctgggcgatcggcacaggcaaggtgcccacggtcgaacagattgcc
gaagtgcacaacgacatgcgcgccagcctcgtgaaacgcttcggcggcgagaccgcaaac
gccatccgactgctctatggcggatctgtcaaagccagcaatgccaaagaaatcttcgcg
gtggcccatgtcgacggcgccctggttggcggcgccagcctcaaggctgcggatttcgcc
cccatcgtcgcggctctcgacgctagcgcataa

DBGET integrated database retrieval system