KEGG   Phaeobacter inhibens DSM 17395: PGA1_c23180Help
Entry
PGA1_c23180       CDS       T02192                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase-like protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00010  Glycolysis / Gluconeogenesis
pga00020  Citrate cycle (TCA cycle)
pga00620  Pyruvate metabolism
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
Module
pga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c23180
   00020 Citrate cycle (TCA cycle)
    PGA1_c23180
   00620 Pyruvate metabolism
    PGA1_c23180
Enzymes [BR:pga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PGA1_c23180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AFO92002
UniProt: I7EYN3
Position
2403920..2404798
Genome map
AA seq 292 aa AA seqDB search
MSDIIAPPSVRALARQKGIDLEKLAKELGRTSIVREDLESGKTTSGPAGDTSYWDVDHSQ
FGSVGEELMSRFAQVAAANLSAANALIPQVTHHDRADVTAIEALRKELKPEAQARGVKLT
ALAFQAKALARALREFPRFNASLSPDGKTLTLKGYVHIGIAVDTAHGLMVPVVHDVDRKG
LWQIAAEISDLASRAQNRKVGPDEMGGASMTITNLGGIGGIGFTPIVNPPEVAILGITRT
ETVTVWDDDTPRPVTMVPLDLSYDHRVINGADAARFVSYFAGLIADPRRIMV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcatcgcaccaccttcggtccgcgcccttgcccgacaaaagggcattgac
ctagaaaaactcgccaaggaactgggacgcacttccatcgtgcgtgaggatctcgaaagc
ggaaaaaccacctccgggcctgctggcgacacgtcctattgggatgtagaccacagccaa
ttcggctccgtgggcgaagaactgatgagccgctttgcccaagtggcggcggccaatctt
agcgcggccaatgccctcatcccgcaggtcacacaccatgatcgtgccgatgtcactgcc
atcgaagcgctgcgcaaagaactgaaaccggaagcacaggcgcgcggcgtcaagctgacc
gcgctggcgtttcaggccaaggcgctggcgcgtgcgttgcgtgaatttccacggttcaat
gcctcgctttcgcctgacggcaagacactgacactcaagggctatgttcacatcggcatc
gccgtagacacggcgcacggcctgatggtgcccgtggtccacgacgtagaccgcaagggg
ctttggcagatcgcggcagagatttccgatctcgcctcacgcgcgcaaaaccgcaaggtt
ggacctgatgaaatgggcggcgcgtcgatgacgatcaccaacctgggtggcatcggtggc
attgggttcacgcctatcgtcaacccgcccgaagtcgccattcttggcatcacacgcacg
gaaacggtcacggtttgggacgacgacaccccccgtcccgtgacaatggtcccgcttgat
ctgagctatgatcaccgcgttatcaacggcgccgatgcggcccgctttgttagctacttt
gcggggctgatcgccgatccccgtcggatcatggtctag

DBGET integrated database retrieval system