KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c23180Help
Entry
PGA1_c23180       CDS       T02192                                 

Definition
dihydrolipoyllysine-residue acetyltransferase-like protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pga01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pga00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pga00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pga00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2403920..2404798
Genome map
AA seq 292 aa AA seqDB search
MSDIIAPPSVRALARQKGIDLEKLAKELGRTSIVREDLESGKTTSGPAGDTSYWDVDHSQ
FGSVGEELMSRFAQVAAANLSAANALIPQVTHHDRADVTAIEALRKELKPEAQARGVKLT
ALAFQAKALARALREFPRFNASLSPDGKTLTLKGYVHIGIAVDTAHGLMVPVVHDVDRKG
LWQIAAEISDLASRAQNRKVGPDEMGGASMTITNLGGIGGIGFTPIVNPPEVAILGITRT
ETVTVWDDDTPRPVTMVPLDLSYDHRVINGADAARFVSYFAGLIADPRRIMV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcatcgcaccaccttcggtccgcgcccttgcccgacaaaagggcattgac
ctagaaaaactcgccaaggaactgggacgcacttccatcgtgcgtgaggatctcgaaagc
ggaaaaaccacctccgggcctgctggcgacacgtcctattgggatgtagaccacagccaa
ttcggctccgtgggcgaagaactgatgagccgctttgcccaagtggcggcggccaatctt
agcgcggccaatgccctcatcccgcaggtcacacaccatgatcgtgccgatgtcactgcc
atcgaagcgctgcgcaaagaactgaaaccggaagcacaggcgcgcggcgtcaagctgacc
gcgctggcgtttcaggccaaggcgctggcgcgtgcgttgcgtgaatttccacggttcaat
gcctcgctttcgcctgacggcaagacactgacactcaagggctatgttcacatcggcatc
gccgtagacacggcgcacggcctgatggtgcccgtggtccacgacgtagaccgcaagggg
ctttggcagatcgcggcagagatttccgatctcgcctcacgcgcgcaaaaccgcaaggtt
ggacctgatgaaatgggcggcgcgtcgatgacgatcaccaacctgggtggcatcggtggc
attgggttcacgcctatcgtcaacccgcccgaagtcgccattcttggcatcacacgcacg
gaaacggtcacggtttgggacgacgacaccccccgtcccgtgacaatggtcccgcttgat
ctgagctatgatcaccgcgttatcaacggcgccgatgcggcccgctttgttagctacttt
gcggggctgatcgccgatccccgtcggatcatggtctag

DBGET integrated database retrieval system