KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c30190Help
Entry
PGA1_c30190       CDS       T02192                                 

Gene name
cycM
Definition
cytochrome c-552
Orthology
K08738  
cytochrome c
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pga00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pga02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3157850..3158353)
Genome map
AA seq 167 aa AA seqDB search
MFDTMTLTKATAGVCGAFLVFLLGKWAAEELYHTESHGEASYVIEVEEAGAEEVAEVVDF
GELMAAADVGKGAKVFKKCSACHKLEAGENATGPYLYGVVDRPIAAADGFGYSATLAGLG
GEWTAEELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYLDSLDD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacgatgacccttaccaaagcgaccgcaggcgtttgcggcgcgttcctcgtg
ttcctcctgggcaaatgggccgcagaggaactctatcatactgaaagccacggcgaggct
tcttatgtgattgaagtggaagaggcaggtgcggaagaagttgctgaagtcgtagacttc
ggcgaactgatggccgcagcagatgttggcaaaggtgccaaggtcttcaagaaatgctcc
gcctgccacaaactcgaagccggtgaaaacgccaccggtccatatctctatggggtggtt
gatcgcccgatcgccgctgcggatggctttggatactctgccaccctggccggtcttggc
ggcgaatggaccgcagaagagttggatgccttcctgaccaaaccgtcacaatatgcgcct
ggtaccaccatgagctttagcgggctgaagaagcagaaggaccgggtgaacctgatcgcc
tatctcgatagcctcgacgattga

DBGET integrated database retrieval system