KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c30290Help
Entry
PGA1_c30290       CDS       T02192                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pga03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3167803..3168402
Genome map
AA seq 199 aa AA seqDB search
MIKNSTTDIEDLIALMAKLPGLGPRSARRAVLHLIRKRALLLTPLAETMSEVAATARECL
NCGNVGTGDLCTICEDMTRANGELCVVEDVSDLWAMERAAVFKGRYHVLGGTLSALDAVG
PEDLRIPRLVDRVQAEQVSEVILALNATIDGQTTAHYIADQLSGQVRLTSLAQGVPIGGE
LDYLDEGTITAALRARKDI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaactcaaccaccgatatcgaagacctgattgccctgatggccaaactgccg
gggctggggccgcgctctgcccgccgggcggtgctgcacctgatccgcaaacgcgccctg
ctgctgaccccattagccgagaccatgagcgaggtagccgccaccgcgcgggaatgcctt
aactgtggcaatgtcggcaccggtgatctctgcaccatctgcgaggatatgacccgtgcg
aacggcgaactctgcgtggtggaggatgtttccgacctctgggccatggaacgtgcggcc
gtcttcaaggggcgctaccacgtgttgggcggaacgctctccgccttggacgcggtcggt
ccggaggatctgcgcattccccgtctggtggaccgggtgcaggccgaacaggtcagcgag
gtcatactggcgctcaacgccacaatcgacggccagacgacggcacattacatcgcggat
cagctcagcggacaagtccgcctgacgtcgctggcgcagggggtgcctattggcggagag
ctcgactatctcgacgagggcaccatcacagccgccctgcgtgcccgcaaggacatctga

DBGET integrated database retrieval system