KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c31220Help
Entry
PGA1_c31220       CDS       T02192                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase MurA (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pga00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pga00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3257846..3259117)
Genome map
AA seq 423 aa AA seqDB search
MDSILVTGNGLLKGQIPIAGAKNACLTLMPATMLSEEPLTLTNAPRLSDIRTMTTLLQSL
GAEVSTLQDGQVLAMSSHDINNHTADYDIVRKMRASILVLGPMLARDGHAVVSLPGGCAI
GARPVDLHLKALEALGAQLDLKDGYVHAKAPLGGLKGGVIDFPLVSVGATENALMAATLA
KGTTLINNAAREPEIVDLAQCLRKMGAQIEGEGTSTITIQGVDRLHGATHPVVTDRIELG
TYMLAPAICGGEVELLGGKRSLIEAFCNKLEAAGVEITENENSLTVRRGDNRVKAVDVVT
EPFPGFPTDLQAQMMALMCTAEGTSVLEEKIFENRFMHAPELIRMGAQIDVQGGHATVTG
VEGLKGAPVMATDLRASVSLILAGLAAEGETTVSRVYHLDRGYEHVVRKLSSVGAKIERI
QEQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggattcgattttggtgacggggaatggcctactgaaagggcagatccctatcgcgggt
gcaaaaaacgcctgtctgacgcttatgccggcaacgatgctgagcgaggagccgttgacg
ctgacaaacgcaccgcgactgtctgacattcgcaccatgacaacgctgttgcagtcgctg
ggtgctgaggtttcaacgctgcaggatggtcaggtgttggccatgtcgagccatgacatc
aacaatcacaccgctgactacgatatcgtgcggaagatgcgggcgtcgatccttgtactg
gggccgatgctggcgcgtgatggtcatgctgttgtctcgttgcccggcggctgcgccatc
ggcgcgcgcccggtggatctgcatttgaaggcgcttgaagcgctgggggcgcagctggat
ctgaaagacggttatgttcatgctaaggcgcctctgggcgggctgaaaggcggggtcatt
gacttcccgcttgtctccgtcggcgcaacggagaatgcgctgatggccgcgacattggcc
aagggtacaacccttatcaataacgcggcgcgcgagccggagatcgttgatctggcgcag
tgcctgcgtaaaatgggtgcgcagattgaaggtgagggtacatccaccatcacgattcaa
ggcgtggaccgtctgcacggcgccactcatccggttgtcaccgaccggatcgagttgggg
acctatatgctggcgcctgccatttgcggtggcgaggtcgagctgctgggtgggaagcga
tccctgatcgaagccttctgtaacaagttggaggctgccggggttgagattaccgagaac
gagaacagcctgacggtacgccgcggtgataaccgggtaaaagcggtagatgtcgtgacc
gaacccttccccgggttcccgaccgacttgcaggcacagatgatggcactgatgtgtacc
gctgaagggaccagtgttctggaagaaaagatctttgaaaaccggttcatgcatgcgccg
gaactgatacgtatgggggcgcagattgacgttcagggtggtcatgccacggtaaccggc
gttgaggggctgaagggcgcaccggtgatggcaactgatctgcgggcgtcggtctccttg
attcttgcaggtctcgcggctgaaggcgagaccaccgttagccgtgtctatcatctggat
cgcgggtatgaacatgtggtgcgcaaattgtcctcagttggtgccaagattgaacggatc
caggagcagtaa

DBGET integrated database retrieval system