KEGG   Phaeobacter inhibens: PGA1_c32000Help
Entry
PGA1_c32000       CDS       T02192                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pga  Phaeobacter inhibens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PGA1_c32000
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA1_c32000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3354390..3354854
Genome map
AA seq 154 aa AA seqDB search
MKLLTAVAALGLIAAPAFAEGDADKGEKGFNKCKSCHMVVSDSGDVIIKGGKTGPNLWGV
VGRTAGTYEGYKYGKDMVAAGEAGLAWDEASFTAYTADPKAFLRDTLGDKKAKSKMSFRL
KKGAEDIYAFLALHGPADAAETEAETTTEETATN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctgactgctgtagcagccctgggcctgattgcggcccctgcctttgccgaa
ggcgatgccgacaagggcgaaaagggcttcaacaaatgcaaatcctgccacatggttgtc
tccgacagcggtgatgtgatcatcaagggtggcaagaccggcccgaacctctggggcgtc
gtcggccgcaccgccggcacctatgagggctacaaatacggcaaggacatggtcgctgcg
ggcgaagcaggcctggcctgggacgaagcctccttcaccgcctataccgccgaccccaaa
gccttcctgcgtgacaccctcggcgataagaaagccaagtccaaaatgtctttccgcctg
aagaaaggcgcggaagatatctacgcattcctcgcgctgcatggtcctgcggatgctgcc
gaaaccgaggcagagaccaccacggaagagaccgcaaccaactga

DBGET integrated database retrieval system