KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c32030Help
Entry
PGA1_c32030       CDS       T02192                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pga00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3357134..3358618)
Genome map
AA seq 494 aa AA seqDB search
MTYILAIDQGTTSTRAILFDDRMQAQGSAQQEFTQHFPQAGWVEHDPENLWSTTLDVCRK
VMAEQGVTAAEIAGIGITNQRETTVVWDRHSGKPIHNAIVWQDRRTSPICEELRAAGHED
SVRQKTGLLLDPYFSGTKLKWILDTVPEARARAEAGDLLFGTVDSFLIWRLTGGASHVTD
ATNAARTLMYDIRKGRWSSEICGFLGVPRDMLPEVKDCAADFGTTKAEFLGGEIAILGVA
GDQQAATIGQACFQPGMMKSTYGTGCFALLNTGDTPVVSQNRMLTTIAYQLDGAPTYALE
GSIFIAGAAVQWLRDGLGIIGSAQESGALARNADPGQDVILVPAFTGLGAPYWKPDCRGG
MFGLTRNSGPAEFARAALQSVAYQTRDLWEAMRADWDGESLVTLRVDGGMSASNWTMQSL
ADLLGAAVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAATWALDQQFTPEMDEDRRSAA
YARWKRAVEAVIGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatattctggcgatagatcagggcacaacctcgaccagagcgatcctgtttgat
gacaggatgcaggcgcagggctcggctcagcaggagtttacccagcattttccgcaggcg
ggctgggtggagcatgacccggaaaacctctggtccacaacgctggatgtctgccgcaag
gtgatggcagagcagggcgttacggcggcggagattgccgggatcggcatcaccaaccag
cgcgaaaccacggtggtctgggatcgtcacagcggcaaaccgatccacaacgccattgtc
tggcaggaccgccgcaccagcccgatctgcgaagagctgcgggcggcaggacatgaggac
agcgtgcggcaaaaaaccgggctgctgctggatccctatttctcgggtaccaagctgaaa
tggattctggataccgtgccggaggcgcgcgcgcgggctgaggccggggatctgttgttc
ggcactgtcgacagtttcctgatctggcgccttacgggtggtgcgtcccatgtgacggat
gccaccaatgcggcgcggactctgatgtatgacatccgcaagggccgctggagcagcgag
atctgcggcttcctcggcgtgccgcgcgacatgctgcccgaggtgaaggactgcgccgct
gatttcggcaccaccaaggcagagtttctgggcggcgagattgccattctgggagtggct
ggcgatcagcaggccgccaccatcggacaggcctgtttccagccgggtatgatgaaatcg
acctatggcacgggctgctttgcgctgctgaacaccggtgatacgccggttgtgtcgcaa
aaccggatgttgaccaccatcgcctatcagctggacggcgcgccgacctatgcgctggag
gggtccattttcatcgcgggcgcggcggtgcaatggctgcgggacgggcttggcattatc
ggctcagcgcaggaaagcggtgccctggcgcgcaatgccgatccgggtcaggacgtcatt
ttagtgccggcctttaccggccttggtgcgccttattggaagccagattgtcggggcggc
atgtttggtctgacacgtaattcgggaccggcggagtttgcccgcgcagcactgcaaagc
gtggcctaccagacccgcgatctgtgggaggcaatgcgggccgattgggatggtgagagc
ctggtgaccctgcgcgttgatggcggtatgagtgcgagcaattggaccatgcagagcttg
gcggacctgttgggcgcagcggtggatcgtccggtgatgcaggaaaccaccgcgctgggt
gcggcctggctggcaggaatgcgggccggagtttatccggatcaggcaggctttgccgcg
acctgggcgctggatcagcagttcaccccggaaatggatgaggatcgccgcagcgctgcc
tatgcgcggtggaagcgcgcggttgaggctgtgatcggggtctga

DBGET integrated database retrieval system