KEGG   Phaeobacter inhibens: PGA1_c32150Help
Entry
PGA1_c32150       CDS       T02192                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pga  Phaeobacter inhibens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PGA1_c32150 (pncA)
Enzymes [BR:pga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PGA1_c32150 (pncA)
    3.5.1.-  
     PGA1_c32150 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3372665..3373270)
Genome map
AA seq 201 aa AA seqDB search
MTKALIVIDVQMDFCPGGALAVPEGDQVVAPINAMMAQYDAVLMTQDWHPGDHSSFASQH
RDAAEYDMIEMPYGPQVLWPDHCVIDSAGAQFHPDLDLRGDLILRKGYRREIDSYSAFFE
NDQSTATGLHGYLQERGISDVTLVGLATDFCVAFSALDAARLGYDVTVDLTACRAIDLGG
SLAAAISKMQTAGVQLRGALR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagccttgatcgtgattgatgtgcagatggacttttgcccgggcggcgctctg
gcggtgccggagggggatcaggttgtggccccgatcaatgcgatgatggcgcaatatgat
gcggttctgatgacccaggattggcaccccggcgaccacagctcctttgcctcgcaacat
cgcgatgccgccgaatatgatatgatcgagatgccctatggcccacaggttctgtggccg
gatcactgtgtgatcgacagcgcaggcgcccagttccatccggatctggatctgcgcggg
gatctcatcctgcgcaaaggttaccggcgtgagatagacagctattcggcgttctttgag
aatgaccagagcacggcaaccggcttgcacggctacctgcaggaacgcgggatttcggat
gtgacgctggttgggctggcgactgatttctgcgttgccttctctgcgctggatgccgcg
cggctgggatatgatgtgacggttgacctgacggcctgccgggcgattgatctgggtggg
tcactggcggcggccatatcgaagatgcagacagctggcgtgcagctgcgcggtgccctt
aggtaa

DBGET integrated database retrieval system