KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c33720Help
Entry
PGA1_c33720       CDS       T02192                                 

Gene name
dcyD2
Definition
D-cysteine desulfhydrase 2 (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pga00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3535048..3536061
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRVHLAHLSTPLEPMERLSKELGVELWIKRDDCTGMSTGGNKTRKLEFLMAEAL
EQGADMVMTQGATQTNHGRQTAAFAAKLGLKCHILLEDRTGYQDSNYNTNGNVLLDHLHG
ATTEKFPGGHDMPGEMEKAAEKMRAKGHKVYVIPGGGSNPTGALGYVNAAFELVSQANDR
GLKIDRLVHATGSSGTQAGLVTGMCAMNAQIPVLGIGTRAPQPKQEQMIFDLACKTAEKL
GCAGIVKREDVMANTDYVGEGYGLPTQSGIEAIQMFAELEGILLDPCYSAKGGAGLIDLA
RKGEFAGERVVFLHTGGAAALGGYDFAFDHANRWVNL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgcccgcttccctcgcgttcatcttgcccatctctcaactccgctggagcca
atggagcggctttcaaaggaactgggggttgagctgtggatcaaacgtgatgactgcact
ggcatgtcgaccggcggtaataaaacccgtaagcttgagtttctgatggccgaggcgctg
gaacagggtgccgatatggtgatgacgcaaggcgcgacacagacaaaccacggccgccaa
accgcggcctttgcagccaagttgggtctcaagtgtcatatcctgttggaagaccgaacc
ggctatcaagacagcaactataacaccaacggcaatgttttgctggaccacctgcatggt
gccacaacagaaaaattcccgggcggccacgacatgcctggtgaaatggagaaagctgcc
gagaagatgcgggcgaagggccacaaggtctatgtcattcccggcggagggtccaacccg
accggcgcgctcggctatgtgaatgccgcttttgaactggtgtcgcaggcgaatgatcgt
ggtctcaaaattgaccgtctggtgcatgccacgggttcttcgggcacgcaggctggcctt
gttaccggcatgtgcgcgatgaatgcgcagattcccgtgctaggtatcggcacacgggcc
ccgcaaccgaaacaggaacagatgattttcgatctggcgtgcaagacggccgaaaagctg
ggctgcgcgggcattgtcaaacgtgaagacgtgatggccaacaccgactatgtgggcgag
ggttacggcttgccgactcaatctggcatcgaagccattcagatgttcgccgagcttgaa
ggcatccttttggacccgtgttattcggccaagggcggtgctggcttgattgatctggca
cgaaaaggagagtttgcaggagagcgcgtggtattcctgcacacaggcggtgcggctgct
ctgggcggctatgactttgcctttgatcacgcaaaccgttgggtaaatctctga

DBGET integrated database retrieval system