KEGG   Phaeobacter inhibens DSM 17395: PGA1_c34480Help
Entry
PGA1_c34480       CDS       T02192                                 

Gene name
celA
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase CelA
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00040  Pentose and glucuronate interconversions
pga00052  Galactose metabolism
pga00500  Starch and sucrose metabolism
pga00520  Amino sugar and nucleotide sugar metabolism
pga01100  Metabolic pathways
pga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGA1_c34480 (celA)
   00052 Galactose metabolism
    PGA1_c34480 (celA)
   00500 Starch and sucrose metabolism
    PGA1_c34480 (celA)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA1_c34480 (celA)
Enzymes [BR:pga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PGA1_c34480 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFO93084
UniProt: I7E5H2
Position
complement(3615576..3616469)
Genome map
AA seq 297 aa AA seqDB search
MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSR
GKGALEDYFDHSPMLEQELRKKGKDDLLDILKATNMDSGAIAYIRQHQALGLGHAVWCAR
RLIANEPFAVILPDDVIAAETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDD
MGSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDI
AADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYINQIAQVDKAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaaaagtaacgaaggcaatttttccggtggccggtcttggaacgcggttcctg
ccggcgaccaaatctgttcccaaagaaatcatgacgctggtggaccgtccgctggtccaa
tacgccattgatgaggcgcgtgaggccgggatcaaggaattcatctttgtaacctcgcgc
ggcaaaggcgcgcttgaggactattttgaccactcgcccatgctcgaacaggagctgcgg
aagaagggcaaggacgaccttctggatatcctgaaggcgaccaatatggattcgggcgcg
atcgcctatattcgtcagcatcaggcgctaggccttggccacgcggtttggtgcgcgcgc
cgtctgatcgccaatgaaccctttgccgtgatcctgcccgatgacgtcatcgcggcggaa
acaccctgtctcaagcagatggtggaagcctatgaagaaaccggcggcaatatggttgcg
gccatggaggttcccccggagcagacatcatcctacggggtgctggatgtgcgcgatgat
atgggatcggtggtgtctgtgaatggcatggttgagaagcccaaagccgaagaggcgcca
tctaatcttgcggtgattggccgctatattctggccccttctgtgctgcggaatctgaac
aagaagaaacagggcgctggcggtgaaatccaactgacggatgccattgcggaagacatc
gccgctgatgtgccggtttatggctaccggttccgtggtcagcgatttgactgcgggtcc
aaggcgggtttcctgcaggcgacggttgccttcgcgctggcgcgtgaggaactccgtgat
gatctgatgtgctatatcaatcagattgcgcaggtcgataaggcggcgcaataa

DBGET integrated database retrieval system