KEGG   Phaeobacter inhibens: PGA1_c34480Help
Entry
PGA1_c34480       CDS       T02192                                 

Gene name
celA
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase CelA (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pga  Phaeobacter inhibens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PGA1_c34480 (celA)
   00052 Galactose metabolism
    PGA1_c34480 (celA)
   00500 Starch and sucrose metabolism
    PGA1_c34480 (celA)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA1_c34480 (celA)
Enzymes [BR:pga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PGA1_c34480 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3615576..3616469)
Genome map
AA seq 297 aa AA seqDB search
MRRKVTKAIFPVAGLGTRFLPATKSVPKEIMTLVDRPLVQYAIDEAREAGIKEFIFVTSR
GKGALEDYFDHSPMLEQELRKKGKDDLLDILKATNMDSGAIAYIRQHQALGLGHAVWCAR
RLIANEPFAVILPDDVIAAETPCLKQMVEAYEETGGNMVAAMEVPPEQTSSYGVLDVRDD
MGSVVSVNGMVEKPKAEEAPSNLAVIGRYILAPSVLRNLNKKKQGAGGEIQLTDAIAEDI
AADVPVYGYRFRGQRFDCGSKAGFLQATVAFALAREELRDDLMCYINQIAQVDKAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaaaagtaacgaaggcaatttttccggtggccggtcttggaacgcggttcctg
ccggcgaccaaatctgttcccaaagaaatcatgacgctggtggaccgtccgctggtccaa
tacgccattgatgaggcgcgtgaggccgggatcaaggaattcatctttgtaacctcgcgc
ggcaaaggcgcgcttgaggactattttgaccactcgcccatgctcgaacaggagctgcgg
aagaagggcaaggacgaccttctggatatcctgaaggcgaccaatatggattcgggcgcg
atcgcctatattcgtcagcatcaggcgctaggccttggccacgcggtttggtgcgcgcgc
cgtctgatcgccaatgaaccctttgccgtgatcctgcccgatgacgtcatcgcggcggaa
acaccctgtctcaagcagatggtggaagcctatgaagaaaccggcggcaatatggttgcg
gccatggaggttcccccggagcagacatcatcctacggggtgctggatgtgcgcgatgat
atgggatcggtggtgtctgtgaatggcatggttgagaagcccaaagccgaagaggcgcca
tctaatcttgcggtgattggccgctatattctggccccttctgtgctgcggaatctgaac
aagaagaaacagggcgctggcggtgaaatccaactgacggatgccattgcggaagacatc
gccgctgatgtgccggtttatggctaccggttccgtggtcagcgatttgactgcgggtcc
aaggcgggtttcctgcaggcgacggttgccttcgcgctggcgcgtgaggaactccgtgat
gatctgatgtgctatatcaatcagattgcgcaggtcgataaggcggcgcaataa

DBGET integrated database retrieval system