KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c34500Help
Entry
PGA1_c34500       CDS       T02192                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pga00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3617456..3618253)
Genome map
AA seq 265 aa AA seqDB search
MTYDDLIPVIRRLAIEAGEKIMEIYNSDEFEVKVKSDESPVTAADEAADALISAGLRAAF
PDVMLVTEEQADSHSKSGDTFLIVDPLDGTKEFIHRRGDFTVNIALVEKGVPTRGVVYAP
ARSRMFFTLADGSAVEETGAFDPAAMGEIKPIRVADSNNDALMVVASKSHRDQATDDYIN
KYAVKDSKSAGSSLKFCLVATGEADLYPRVGRTMEWDTAAGHAVLGGAGGQVVRFDDHAP
LTYGKEGYANPFFIAYAPGVELKKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgacatatgatgaccttattccggtaattcgccgattggcgatcgaggccggagagaag
atcatggagatctacaactcggatgaattcgaggtgaaggtgaagtcggacgaaagcccg
gtcactgccgccgatgaggccgcagatgcgctgatctctgccgggctgcgggcggcattt
ccggatgtgatgctggtgaccgaagagcaggccgattcgcatagcaagagcggcgacact
tttctgatcgttgaccccttggatggaaccaaggagtttattcatcgccgcggtgacttc
accgtcaatatcgcgctggttgaaaaaggtgtgccgacccgtggtgtggtctatgcgccg
gcgcggtcgcggatgttcttcaccttggcggacggatcagcggttgaggaaaccggcgct
tttgatcccgcagccatgggagagatcaagcccattcgtgttgcagacagcaataatgat
gcgctgatggtggttgcctccaaatcgcatcgcgatcaggcgactgatgactacatcaat
aaatatgctgtgaaagacagtaaaagtgcgggatcctcgttgaagttctgtctggtcgcc
accggggaagccgatctttatccacgggttggccgcaccatggaatgggacactgcggcc
ggtcatgctgttctgggtggagcaggtggccaagtggtgcgtttcgatgaccacgcccca
ctcacttatggcaaggaggggtatgccaaccccttctttatcgcctacgcgccgggtgtg
gagttgaaaaaagcctga

DBGET integrated database retrieval system