KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c36420Help
Entry
PGA1_c36420       CDS       T02192                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pga01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pga00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3810367..3811524
Genome map
AA seq 385 aa AA seqDB search
MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVDRGEVSNLIARWGD
KGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDL
VQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMGEMIKI
GRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVT
IDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKDFGVDIAVEIKVSGE
SFITPPGPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDE
RVEIAQIHQLKSIYGRILRDYFDQN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattcgccactcgacccgcaacaactgaccgccgatctgatccgctgtgcctct
gtcacaccggaggagggcggtgcgctggtccttctggacaaggtgctgagtgcggctggc
tttacctgtacccgtgtggatcgtggcgaggtcagcaatctgattgcccgctggggtgac
aaggggcacccgcgcaccatgggcttcaatggtcataccgatgtggtgccggtaggtgac
acgaatgcctggaccgttgacccttttggtgccgaggagaaagacggttttctctatgga
cgtggggcgactgacatgaaatcgggcgtcgccgcctttgtggctgctgctattgatttg
gttcagaccacaccgcccgatggggccattctcctgaccatcaccggagacgaagaaggt
gatgccatcgatggtacgaccgcgttgctggaccacatggaccgcgagggcgaacaaatg
gctgtctgtctggtgggagagccgacctgccccgataagatgggtgagatgatcaagatc
gggcgtcgcgggtcgctgtccgcctggttcacggtcaccggcgtgcaaggtcattcggcc
tatcctcaccgcgccaagaacccgctgaatgctatggtgcgcctgatggaccgccttgcc
agccacgagttggatcagggcacggagcattttgatgcctccacccttgcggtggtgact
atcgataccggcaacccggctaccaatgtcattcccgcgcagacgcgctccacggtcaat
atccgttttaacgatgcccataccggcgcggagctcagcgattggctgcgcgcagaagcg
gcgcgtgcggcaaaggattttggtgttgatatcgcggtggaaatcaaagtctccggcgag
agtttcatcacgccgccagggccgctgtccgatcttgtcagcgccgcagtcgagaccgag
accggtcgcaaacctcagctgtccaccactggcgggacctcggatgcgcggtttgtcaaa
aaccactgcccggtggttgaagtaggtttggtcggaaaaacgatgcatcaggtcgatgaa
cgggtggaaattgcccagatccaccagctcaaatcgatttatggccgcatcctgcgcgat
tatttcgaccaaaactga

DBGET integrated database retrieval system