KEGG   Phaeobacter gallaeciensis DSM 17395: PGA1_c36490Help
Entry
PGA1_c36490       CDS       T02192                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:4.2.99.18 3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pga  Phaeobacter gallaeciensis DSM 17395
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pga03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3819094..3819945
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLSPAMEGAVIKKAAVNRPDLRWPFPERMAERLTGRCVTALRRRSKYI
LADLDSGETLLVHLGMSGRMTVSGDPLGRFVHDHPKAQKHDHVVFDMDNGARITFNDPRR
FGAMDLLETATADQHKLLAVLGPEPLGNSFHEEHLIAAFKGRNTPVKSALLDQGIIAGLG
NIYVCEALFRAGISPQRKAGQIAAQRVGALVPIIKDVLTDAIKAGGSSLKDFRQADGELG
YFQHSFDVYGREGEPCRRAKCDGTVGRITQSGRSSFYCGKCQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattgcccgaggtcgagacggtgcgccgcggattatcccccgcgatggaggga
gcggtgatcaaaaaggctgccgttaaccggcccgatctgcgctggccctttcccgaacgt
atggccgaacggctgaccgggcgttgtgtcaccgcgctccggcggcgctccaagtacatc
ttggccgatctggacagcggcgaaacgctgctggtgcatcttggcatgtcggggcgcatg
accgtctctggtgaccctctgggccggttcgttcatgaccatccgaaggcgcagaaacac
gatcatgtggtgttcgatatggacaatggtgcgcgcatcaccttcaacgatccgcgccga
tttggcgctatggacctgctggagacggccactgcggatcagcacaagcttctggcggtt
ctggggccggaaccgcttggcaatagctttcacgaagaacacctgatcgcggccttcaag
gggcgcaatacgcctgtgaaatcggcgcttctggatcagggaatcatcgcgggtcttggt
aatatctatgtctgcgaggcgctatttcgcgcgggaatatcgccacagcgcaaggctggg
cagatcgccgcgcaacgagttggcgccttggttccgatcattaaggacgtactgacggat
gccattaaggcgggcggctcatcgcttaaggatttccgccaagccgatggagaacttgga
tatttccagcacagctttgatgtttatggccgcgagggggagccctgtcgacgcgcgaaa
tgtgatggtaccgtaggtcggatcacccagtcggggcgctcctccttctactgtggcaaa
tgccaaagatag

DBGET integrated database retrieval system