KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_02536Help
Entry
Gal_02536         CDS       T02968                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gal_02536
   00330 Arginine and proline metabolism
    Gal_02536
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Gal_02536
Enzymes [BR:pgd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Gal_02536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2554085..2554999
Genome map
AA seq 304 aa AA seqDB search
MATKLQSVLDEISQQMRASTDWGEVASYIPELGEVRPDQFAISVATADGALFSAGDFQTR
FSAQSITKVFTLAIALGRAGDQLWQRVGREPSGTAFNSIVQLEHEQGRPRNPFVNAGAIV
TTDEVLAGREPREALAEFLGFVRAAAEDDDIHINADVARSETAHGHRNAAHAHFLASFGN
LKNPPEKVLGTYFHHCATEMTTQQLAKAGRFLIGTGSYPRMVSLDRVRRLNALMLTCGHY
DGSGEFAYRVGLPAKSGVGGGILGVVPGQASIAVWSPGLNRNGNSKLGTEAMEQLAREMD
WSVF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaagttacagagcgttcttgacgagatcagccagcagatgcgggccagcacc
gactggggcgaggttgccagctatatccccgaactgggcgaggtgcgccccgatcaattt
gctatcagcgtggcaacggcggatggcgcgctgttcagcgctggtgactttcagacacgg
ttttcggcccaaagcatcaccaaagtgttcacccttgccatcgctctgggacgtgcgggg
gatcagctttggcagcgggttggccgcgaaccgtccggcacggccttcaactccatcgta
cagctggaacatgagcagggccgcccgcgcaaccccttcgtcaatgcgggcgctattgtc
accaccgatgaggtgctggcaggccgcgaaccccgcgaggcgctggcggaattcctcggc
tttgtacgtgccgcggcagaagatgacgacattcatatcaacgccgatgtggcgcgttcc
gaaaccgctcatgggcaccgaaacgcagcccatgcccattttctggcgtcctttggcaac
ctcaaaaacccgccggaaaaggtgctgggcacctattttcatcattgcgccaccgagatg
acaacccagcagcttgccaaggcaggacgtttcctgatcggcaccggcagttacccccgg
atggtgtcgctggaccgagtgcggcggctcaatgcgctgatgctgacctgcgggcattat
gacgggtcaggtgaatttgcctaccgcgtgggcctacccgccaaaagcggcgtgggcggc
ggcatcctcggtgttgtgccgggacaggcgagcatcgccgtctggtccccaggactaaac
cgcaacggcaattccaaattgggcaccgaagcgatggagcaactggcccgtgaaatggac
tggtcagtcttctag

DBGET integrated database retrieval system