KEGG   Phaeobacter gallaeciensis DSM 26640: Gal_03566Help
Entry
Gal_03566         CDS       T02968                                 

Definition
Sugar kinase, ribokinase family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pgd  Phaeobacter gallaeciensis DSM 26640
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pgd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gal_03566
Enzymes [BR:pgd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Gal_03566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3624056..3624928)
Genome map
AA seq 290 aa AA seqDB search
MAIWNLGSINADMIYALPHMPTAGETLAATGLEQFLGGKGANMSVAAARAGSHVCHLGAV
GPEGTWAVTRLLEYGVDTRHIAQLEVPTGHAIIAVDPSGENQIILFPGANREISDDQIGA
ALSTASAGDILVMQNETNMQAEAAQMGRDLGLKVAYAAAPFDAGAVQAVLPYLDYLFLNE
VEAEQLREATGKTPEALGVADVIVTLGAKGARHYDTMAGTTHDVAAHSVVPVDTTGAGDT
FTGYVLSGLDRGLPMAQALAQANRAAALMVTRKGTADVIPDLKEVQDTSF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctggaatctcggctcaatcaatgccgacatgatttatgcgctgcctcatatg
ccgaccgcgggggaaaccctcgcggcgacggggctggagcagtttctgggcggcaagggg
gccaatatgtcggttgcggctgcgcgtgctggcagccatgtctgtcacttgggcgccgtt
gggccagaggggacctgggctgtcacacgtcttttggaatatggggtcgatacgcgccat
atcgcacagctggaggtgccgaccggtcatgcgatcatcgccgtggatccttcgggtgag
aaccagatcatcctgttccccggagcaaaccgtgagatcagcgacgatcagattggtgca
gcgctgtctaccgccagtgcgggcgatatccttgtgatgcaaaacgaaaccaatatgcag
gctgaggcagcccaaatggggcgtgatctggggttgaaggtggcttatgcagcggccccg
tttgacgcaggagccgttcaggcggttctgccctatctcgactatctgttcctgaatgag
gttgaggccgaacagctgcgtgaggcgacaggcaagacacccgaggcgctgggcgttgcg
gatgtgattgtgacgctgggcgccaagggcgcgcgccactacgacaccatggcagggact
acccatgatgtcgcggcgcattccgttgtcccggttgatacaacaggggctggtgatacc
ttcaccggctatgtgctgtctggtctggatcgtggactgccgatggcgcaggcattggcg
caggccaatcgcgccgctgcattgatggtgacgcgtaagggcaccgccgatgtgatccct
gatctgaaagaggttcaggacacaagtttttga

DBGET integrated database retrieval system