KEGG   Porphyromonas gingivalis W83: PG0084Help
Entry
PG0084            CDS       T00145                                 

Gene name
sda
Definition
L-serine dehydratase
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pgi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pgi00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pgi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
97972..99171
Genome map
AA seq 399 aa AA seqDB search
MESITQIYRIGYGPSSSHTIGPRRAAEMFLDRNPRATSFRVTLYGSLAATGKGHLTDAAI
LAVLEAKAPTEIVWKPEIFQNFHPNGMLFESFDKEGKQLDDWLIYSIGGGVLANEHFNEQ
RGREVYPLSKMADILDELNRRGLSYWEYVEENEDPDIWDYLAEVWSVMRSAIQEGLDAEG
VLPGGLGVRRKAASYLIRAQGYSPGVRSRGNVYAYALAVSEQNASGGKIVTAPTCGSCGV
VPAVLHHLQQTRDFSDKRILRALATAGLFANVVRTNASISGAEVGCQGEVGVACAMGAAA
SSQLFGGTLSQIEYAAEMALEHHLGLTCDPVCGLVQVPCIERNAFAAARALDANTYANFS
DGRHRISFDQVVEVMRQTGKDLPSLYKETSQGGLAIVHC
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgataacccaaatatatcgcatcggctacggtccgagcagtagccacacgatt
ggcccacgtcgggctgctgagatgtttctcgatcggaacccccgggcgacctctttccgt
gttacgctatacggcagccttgctgccacgggcaaaggacacctcacggatgcagctatc
cttgccgtcttggaagcaaaggctccgaccgaaatcgtttggaaaccggagatcttccaa
aattttcaccccaacggcatgctcttcgagagcttcgacaaagagggcaagcagctcgac
gactggctcatctatagcatcggcggcggagtcttggccaacgaacacttcaacgaacag
cgaggtcgcgaggtatatccgctcagcaagatggcagatattctcgacgaactgaacagg
cgcggcctaagctattgggagtatgtggaagaaaacgaagatcccgatatatgggactat
ttggctgaggtctggtcggtaatgcggagcgccattcaggaggggctcgatgctgagggg
gtgctgccgggtggactgggcgttcgccggaaggcagccagctatctgattcgtgcgcag
gggtattcgccgggtgtacgaagccgaggcaatgtatatgcctatgctttggctgtgagc
gaacagaatgcatcgggtggcaagatcgtaacggcgccgacatgtgggtcgtgcggcgtt
gtaccggcggtactccaccacctccaacagactcgtgacttcagcgataagcgcatattg
cgtgcactggctacggccggcctttttgctaatgtggtacgcaccaatgcttctatttcg
ggtgcagaagtcggctgtcagggcgaagtgggagtggcttgtgccatgggagcggcagcc
agcagccagctattcgggggtaccctgtcccaaatcgaatatgctgcagagatggctttg
gagcatcacctcggactgacctgcgaccctgtatgcggattggtgcaggtaccttgtatc
gaacgaaatgcctttgcggcagcacgagctttggatgccaatacttatgccaatttcagc
gatggcagacaccgcatttcgttcgatcaggtcgtggaagtgatgcgtcagacgggcaag
gatttgccgagtctatataaggaaacctctcagggtggattggccatagtacactgctga

DBGET integrated database retrieval system