KEGG   Porphyromonas gingivalis W83: PG0525Help
Entry
PG0525            CDS       T00145                                 

Gene name
pyrG
Definition
CTP synthetase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PG0525 (pyrG)
Enzymes [BR:pgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     PG0525 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569139..570758
Genome map
AA seq 539 aa AA seqDB search
MADTKYIFVTGGVVSSLGKGIVAASLGKLLQARGFNVALQKFDPYINIDPGTLNPYEHGE
CYVTEDGHEADLDLGHYERFLNTPTTRANNITTGRIYQNVIRKERKGEYLGKTVQVVPHI
TDEIKRNVKLLGQKSQYDFVITEIGGTVGDIESLPFLESVRQLKWELGQNCLCVHLTYVP
YIAAAGEVKTKPTQHSVKQLQEVGIQPDILVLRTEHELQPDILKKVALFCNVAPDSVVQS
VDVPTIYEVPLVLQQQHMDETVLRKVGLQVGPVPEMRQWHEFLEMKHTARETVTIALVGK
YVELQDAYKSIDESLMQAAIYNRKKLNLISVHSEKVTEANVAETLKDMDGIVIAPGFGSR
GVEGKLIALKYARENDLPTLGICLGMQCMVIEYARNVLGFKDANTTEIESNIEHKVIDLM
DEQKTVTDMGGSMRLGAYDCALRKGSKLAAAYGKEFVRERHRHRFEFNSQYREAFEKAGM
QCVGENPETGLVEAVEVPACRWFVGVQFHPEYNSTVVNPNPLFMAFIREAIKTRKKDKE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcagatactaagtatatcttcgtgaccggtggtgtggtttcttctcttggaaaaggc
atcgtagcagcatctctcggcaaactcctccaagctcgcggtttcaacgtagctcttcag
aagttcgacccctatatcaatatcgatcccggtacgctcaatccttatgagcacggcgaa
tgctatgtcaccgaggacggacatgaggccgatttggatctcggccactatgagcgtttc
ctcaatacgcccactactcgtgccaataatatcacgacaggcaggatctatcagaacgta
atccgcaaggaacgcaagggcgagtacttgggcaagaccgtgcaagtggtgcctcatatt
acggatgagatcaagcgcaacgtcaaactcctgggacaaaagagtcagtacgactttgtc
atcacagagataggcggtacggtaggagacatcgaatccctacccttccttgaaagcgtg
cgtcagctcaagtgggagttggggcagaattgcctctgcgttcacttgacctatgtaccc
tacattgctgctgccggcgaggtgaagaccaagccgactcagcactccgtgaagcagttg
caggaagtgggtattcagcccgacatccttgtattgagaacggagcacgagcttcagccc
gacattttgaagaaggtagccctgttctgcaacgtggctcccgattcggtggtacagagt
gtggacgtgcctactatctatgaggtgcctctggtcttgcagcagcagcatatggacgag
acggtacttcggaaagtggggctgcaagtgggacctgtgcccgagatgcgtcagtggcat
gaatttttggaaatgaagcatacggcccgagaaacggttacgatcgctttggtgggtaag
tatgtggagcttcaggatgcgtacaagtccatagacgaatcgctgatgcaggcggctata
tataataggaagaagctgaacctcatatccgttcacagcgaaaaggtgacggaggctaac
gtagccgagaccctgaaagatatggacggcatcgtgatcgcccccggattcggttccaga
ggggtcgaaggcaaactcatagcactgaaatatgcgcgtgagaacgatctgcccacactg
ggtatctgtctgggtatgcagtgtatggtgatcgaatatgctcgcaatgtattgggcttc
aaggacgccaatacgacggagatcgaatccaatatcgagcacaaggtcatcgacctgatg
gacgaacagaagacggttacggatatgggcggttccatgcgtttgggcgcatacgactgt
gctctgcgcaaaggatcgaaattggctgctgcctatggcaaggaattcgtgcgcgaacgc
catcgccatcgcttcgaattcaacagccagtatcgcgaagctttcgaaaaagccggtatg
caatgtgtgggcgagaatccggagacgggcttggtagaagccgtggaagtgcctgcctgc
cgctggttcgtgggggtacagttccatcccgaatacaatagtacggtggtcaatcccaac
cccttgttcatggctttcattcgtgaagcaatcaaaacgagaaaaaaagataaagaataa

DBGET integrated database retrieval system