KEGG   Porphyromonas gingivalis W83: PG0623Help
Entry
PG0623            CDS       T00145                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PG0623 (tpiA)
   01230 Biosynthesis of amino acids
    PG0623 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PG0623 (tpiA)
   00051 Fructose and mannose metabolism
    PG0623 (tpiA)
   00562 Inositol phosphate metabolism
    PG0623 (tpiA)
Enzymes [BR:pgi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PG0623 (tpiA)
Exosome [BR:pgi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PG0623 (tpiA)
  Exosomal proteins of bladder cancer cells
   PG0623 (tpiA)
  Exosomal proteins of melanoma cells
   PG0623 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677401..678156
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGLALAKELDAALKGRTINCDVIIGTPFIHLASIAAAIDTTRI
GVAAENCADKESGAYTGEVSAAMVASTGARYVIIGHSERRAYYHETSPILMEKVKLALSN
GLTPIFCVGEVLEEREAGKHFEVVARQVEEALFTLDQTDFAKLILAYEPVWAIGTGKTAT
ADQAQEMHAHIRKSIAAKYGKEVANGCSILYGGSCNAANAKELFSRADVDGGLIGGASLS
VDKFLPIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacatcgtagcaggcaactggaaaatgaacaaaaccctccaagaggggctt
gcattggcaaaggagttggacgcagctttgaaagggcgtacgatcaactgtgacgtgatt
atcggaaccccattcatccatttggcaagtattgcggcagccatcgataccacacgtatc
ggagttgcagctgaaaactgtgccgataaggagtcgggtgcatataccggagaggtctct
gctgctatggtagccagtaccggtgctcggtatgtgattataggacatagcgaacgccgt
gcttactatcatgaaacatccccaatcctgatggagaaggtgaagttggctttgtccaat
ggcttgacccccattttctgtgttggcgaagtcttggaagagcgcgaagcaggcaagcac
ttcgaggtagtcgctcgtcaggtggaagaagccctgtttactttggatcagaccgacttt
gccaaattgatccttgcttacgagcctgtgtgggccatcggtacgggtaagacggctacg
gcagaccaagctcaagagatgcatgcacatattcgtaagagtatagccgctaaatatgga
aaagaggttgcgaacggttgttccattctctatggaggcagttgcaatgcagccaatgcc
aaagaactctttagccgtgcggatgtagatggtgggcttatcggaggggcttctctctcg
gtagacaaattcttgcctatcatcgaagcattctga

DBGET integrated database retrieval system