KEGG   Porphyromonas gingivalis W83: PG0625Help
Entry
PG0625            CDS       T00145                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
678728..679309
Genome map
AA seq 193 aa AA seqDB search
MTEIEKEEACSRLQQHYAQVLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDPEAILR
AAMFEEDYQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARR
LQVQERLTTQIKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEEST
TREEFLNLIGRRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatagaaaaagaagaagcctgcagccgcttgcaacagcattacgcccaagta
ctgtcgttgctcggcgaagaccctaagcgtgaagggctgctcaaaactccgctacgtgtg
gctaaggccatgcagtttctgaccaaaggatataacgaggatcctgaagccatccttcgc
gcagcgatgttcgaagaagactatcagcaaatggtcatcgtcaaggacatcgatttcttt
tcgatgtgtgagcaccacatgttgccgttcttcggtaaggcccatgtgggctatatcccc
aatcggtatataaccggactgagcaagttgccccgagtggtcgatgtatttgcccgtcgt
cttcaggtacaggaacggctgactacacaaatcaaggagtgcatccagaatacgctgaac
cctctcggggtgatcgtcgttatcgaagcacagcacatgtgcatgcagatgcgtggagtg
gagaagcaaaactctctgactacgaccagtgactttacaggagcttttgaggaatcgacc
actcgcgaagagtttctcaatctgatcggtcgcaggcgataa

DBGET integrated database retrieval system