KEGG   Porphyromonas gingivalis W83: PG0678Help
Entry
PG0678            CDS       T00145                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pgi00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
729019..729531
Genome map
AA seq 170 aa AA seqDB search
MVLLIVDPQVDFVSGSLAVEGAPKAMKALAEYMAAHRKEIKSIVVTMDQHPADHCSFVAQ
GGQWPSHCVRYTVGAAIEPCIAEALAACSAEGIPVEMIEKATTQERDAYSAFETEVPDSL
RSAERIVVAGIAGDYCVRQSVLDLERHGLGERIELLKEGIAYIAEEENRP
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggtacttttgatcgtggatccgcaggtggatttcgtaagcggttcgttggctgtcgaa
ggtgcaccgaaagccatgaaggctttggctgaatatatggctgcacatcggaaggagata
aagtctatcgtcgtgacgatggatcagcatccggccgatcattgcagcttcgtggcacag
ggcggacagtggccgtcgcattgtgtccgctatacggtgggagccgctatcgaaccatgc
attgcggaggctctggctgcttgttcggccgagggtatccctgtcgaaatgatagagaag
gctactacgcaggagcgcgatgcttacagtgccttcgagacggaagtacccgattcgttg
cgctcggccgaacgtatagtcgtggccggaatagcgggcgattactgcgtgcgtcagagc
gtgctcgatctggagcgtcatggtctcggcgagcgcatcgaacttctcaaggagggaatc
gcctatatagcggaagaggaaaaccggccataa

DBGET integrated database retrieval system