KEGG   Porphyromonas gingivalis W83: PG0811Help
Entry
PG0811            CDS       T00145                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PG0811 (ruvA)
Enzymes [BR:pgi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PG0811 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(872691..873299)
Genome map
AA seq 202 aa AA seqDB search
MIEYLKGAIVGLTPTNLVIECAGVGYDVNVSLTTYSAYQGKKEGLIWITQLIREDAHLLY
GFSTKEERTLFGQLTSVSGVGPTTAQLILSSYAPQELAALITTGQADALKAVKGIGLKTA
QRIIVDLKGKIQLETSSDEILSARTAVGDAALNTIASGEEAISALKMLGFADPAIRKAVK
SILSEDSSLAVEDIIKRALRML
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatagagtatctcaagggtgcaatagtcggtttgacgccgacaaacctcgtgatcgag
tgtgcgggagtgggttatgatgtgaatgtctcgctcaccacttattctgcctatcagggg
aagaaagagggacttatttggattacacaactgatccgagaagatgcccatttattgtat
ggcttttccacgaaagaagagcgtacgctcttcggccaactcacatctgtcagcggtgtc
gggcctacgacggcacagctcatcctatcttcctatgctcctcaagagctggccgcactc
attaccacagggcaggccgatgcgctgaaagccgtgaagggcatcggtctgaagaccgct
cagcgtatcatcgtggatctgaaaggtaagatacaactggaaacctcctcagacgagatc
ttgtctgcacggacggctgtaggagatgctgctctgaataccatagcttcgggagaagaa
gccatcagtgctctaaagatgcttggctttgccgatccggctatacgcaaagcggtcaag
tccattctctccgaggattcgtccttagctgtcgaagatattatcaagcgagcattacga
atgttataa

DBGET integrated database retrieval system