KEGG   Porphyromonas gingivalis W83: PG0811Help
Entry
PG0811            CDS       T00145                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pgi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(872691..873299)
Genome map
AA seq 202 aa AA seqDB search
MIEYLKGAIVGLTPTNLVIECAGVGYDVNVSLTTYSAYQGKKEGLIWITQLIREDAHLLY
GFSTKEERTLFGQLTSVSGVGPTTAQLILSSYAPQELAALITTGQADALKAVKGIGLKTA
QRIIVDLKGKIQLETSSDEILSARTAVGDAALNTIASGEEAISALKMLGFADPAIRKAVK
SILSEDSSLAVEDIIKRALRML
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatagagtatctcaagggtgcaatagtcggtttgacgccgacaaacctcgtgatcgag
tgtgcgggagtgggttatgatgtgaatgtctcgctcaccacttattctgcctatcagggg
aagaaagagggacttatttggattacacaactgatccgagaagatgcccatttattgtat
ggcttttccacgaaagaagagcgtacgctcttcggccaactcacatctgtcagcggtgtc
gggcctacgacggcacagctcatcctatcttcctatgctcctcaagagctggccgcactc
attaccacagggcaggccgatgcgctgaaagccgtgaagggcatcggtctgaagaccgct
cagcgtatcatcgtggatctgaaaggtaagatacaactggaaacctcctcagacgagatc
ttgtctgcacggacggctgtaggagatgctgctctgaataccatagcttcgggagaagaa
gccatcagtgctctaaagatgcttggctttgccgatccggctatacgcaaagcggtcaag
tccattctctccgaggattcgtccttagctgtcgaagatattatcaagcgagcattacga
atgttataa

DBGET integrated database retrieval system