KEGG   Porphyromonas gingivalis W83: PG0890Help
Entry
PG0890            CDS       T00145                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pgi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
951472..953163
Genome map
AA seq 563 aa AA seqDB search
MKRIKQTLSTILLFIIVLSPALYAGQPREVKPVRNVILMIPDGTSLSAVSLARWYQRYLN
PDRRHLAIDPYICGTVLTYSSDAPIGDSAPTTSCYMTGMPSNTGFVSTYPVSSGDADLIP
VDKARAYSPLATFLEAAKIMKGKKTGLVVTCHFPHATPADCSAHSYSRKKYDWIAAQMVH
QNLDVVLGGGTHYLHPELQSVLNSRGYGLFLDDLNGMRTYAGDRMWALFGKREMPYDLDR
DTTQIPSLEEMTRLAIEKLNRSEEGFFLMVEGSKVDWAAHANDPVGIATEYLAFDRACAV
AFDFARRDGQTAVIIVPDHGNSGVSIGKQSVKDYDKRSAKDLFDQLCRFRLTADGLAGRL
ADTPADKVQGLVSNICGFELDAKELEALYNCPDYNHSPIPKEQRRQTEESLYSGSLSTFI
ASLYTKHTSIGFTTHGHTAEEVLLAAYHPQDTRPMGMVINYELNDYLCRLFELGSQLPVL
TDKIFAPHTEVFQGMSYSIKDGKKEGELPVLEVKKGSHRLLASPFSNTVIFNKKAIDLSS
VVVYVDKTKTFYLPRELRSLFGE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcaaacaaactcttagtacgattcttctttttattatcgtactctctccg
gctctatatgccggtcagccacgggaggtcaagccagttcggaacgtgattctgatgatt
cccgatggtacctctctttcggctgtttctctcgctcgctggtatcagcgatacctgaat
cccgaccgccggcatttggctatagatccatatatatgtggtactgttctgacctattcg
tccgatgccccgattggagactctgcacctactacatcgtgctatatgacaggtatgcca
tccaatacgggttttgtgtcgacttatcctgtcagttcgggtgatgcagatctgattccg
gtggataaggctcgtgcttattctcctttggctacttttctggaggcggctaaaataatg
aagggaaagaaaacgggtttggtcgtgacttgtcacttccctcatgccacaccggccgat
tgctcggcacactcttattctcgtaagaaatacgattggattgcagcgcagatggtacac
caaaatctggatgttgtactcggaggcggaacacactacctccatccggaactgcaatcc
gtactcaatagccgtggctatgggctctttctggatgacctgaatggaatgcgcacttat
gcgggagataggatgtgggctttgttcggcaaacgggaaatgccctatgatttagatcgt
gatactacacaaatcccttcactggaggagatgactcgcttggctatagagaagctgaat
cgttctgaggaaggctttttccttatggtcgagggtagtaaagtggattgggctgcacat
gccaacgatcctgtggggattgctaccgaatatcttgctttcgatcgtgcttgtgccgtg
gcattcgactttgcccgtcgtgacggacaaacggctgtcatcatcgtgccggatcatggc
aatagcggtgtaagcataggcaaacaaagtgtgaaagactatgataagcgttctgcaaaa
gaccttttcgatcaactctgtcgcttccgcctgacagcagacggacttgcagggcgtttg
gctgatactcccgccgacaaggtccagggtttggtaagcaatatctgcggattcgaattg
gacgccaaagagttggaagctctttataattgtccggattataatcatagtcctatcccc
aaagagcagcgcaggcagacggaagaatccctctacagcggttcgctcagtaccttcatc
gcatcgctttatacgaagcacacttcgatcggttttacgacgcacggacatactgccgaa
gaagtattgttggcggcctatcacccccaagatacacgcccgatgggaatggtcataaac
tatgaactgaatgactatctctgccgtctcttcgaattaggaagccaattgcccgtcctt
accgacaagatatttgctccccatacggaagtattccaaggcatgagctacagtatcaaa
gacggaaagaaggaaggagaactgcctgttcttgaagtgaaaaaaggtagccatcgctta
ctggcgagtcctttctccaatacggttatcttcaataagaaagcgattgatctgtcttcc
gtagtagtctatgtagataagactaagactttctatttgcctcgtgaactgcgttcttta
ttcggagaataa

DBGET integrated database retrieval system