KEGG   Porphyromonas gingivalis W83: PG0890Help
Entry
PG0890            CDS       T00145                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PG0890
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PG0890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PG0890
Enzymes [BR:pgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PG0890
Exosome [BR:pgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PG0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
951472..953163
Genome map
AA seq 563 aa AA seqDB search
MKRIKQTLSTILLFIIVLSPALYAGQPREVKPVRNVILMIPDGTSLSAVSLARWYQRYLN
PDRRHLAIDPYICGTVLTYSSDAPIGDSAPTTSCYMTGMPSNTGFVSTYPVSSGDADLIP
VDKARAYSPLATFLEAAKIMKGKKTGLVVTCHFPHATPADCSAHSYSRKKYDWIAAQMVH
QNLDVVLGGGTHYLHPELQSVLNSRGYGLFLDDLNGMRTYAGDRMWALFGKREMPYDLDR
DTTQIPSLEEMTRLAIEKLNRSEEGFFLMVEGSKVDWAAHANDPVGIATEYLAFDRACAV
AFDFARRDGQTAVIIVPDHGNSGVSIGKQSVKDYDKRSAKDLFDQLCRFRLTADGLAGRL
ADTPADKVQGLVSNICGFELDAKELEALYNCPDYNHSPIPKEQRRQTEESLYSGSLSTFI
ASLYTKHTSIGFTTHGHTAEEVLLAAYHPQDTRPMGMVINYELNDYLCRLFELGSQLPVL
TDKIFAPHTEVFQGMSYSIKDGKKEGELPVLEVKKGSHRLLASPFSNTVIFNKKAIDLSS
VVVYVDKTKTFYLPRELRSLFGE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatcaaacaaactcttagtacgattcttctttttattatcgtactctctccg
gctctatatgccggtcagccacgggaggtcaagccagttcggaacgtgattctgatgatt
cccgatggtacctctctttcggctgtttctctcgctcgctggtatcagcgatacctgaat
cccgaccgccggcatttggctatagatccatatatatgtggtactgttctgacctattcg
tccgatgccccgattggagactctgcacctactacatcgtgctatatgacaggtatgcca
tccaatacgggttttgtgtcgacttatcctgtcagttcgggtgatgcagatctgattccg
gtggataaggctcgtgcttattctcctttggctacttttctggaggcggctaaaataatg
aagggaaagaaaacgggtttggtcgtgacttgtcacttccctcatgccacaccggccgat
tgctcggcacactcttattctcgtaagaaatacgattggattgcagcgcagatggtacac
caaaatctggatgttgtactcggaggcggaacacactacctccatccggaactgcaatcc
gtactcaatagccgtggctatgggctctttctggatgacctgaatggaatgcgcacttat
gcgggagataggatgtgggctttgttcggcaaacgggaaatgccctatgatttagatcgt
gatactacacaaatcccttcactggaggagatgactcgcttggctatagagaagctgaat
cgttctgaggaaggctttttccttatggtcgagggtagtaaagtggattgggctgcacat
gccaacgatcctgtggggattgctaccgaatatcttgctttcgatcgtgcttgtgccgtg
gcattcgactttgcccgtcgtgacggacaaacggctgtcatcatcgtgccggatcatggc
aatagcggtgtaagcataggcaaacaaagtgtgaaagactatgataagcgttctgcaaaa
gaccttttcgatcaactctgtcgcttccgcctgacagcagacggacttgcagggcgtttg
gctgatactcccgccgacaaggtccagggtttggtaagcaatatctgcggattcgaattg
gacgccaaagagttggaagctctttataattgtccggattataatcatagtcctatcccc
aaagagcagcgcaggcagacggaagaatccctctacagcggttcgctcagtaccttcatc
gcatcgctttatacgaagcacacttcgatcggttttacgacgcacggacatactgccgaa
gaagtattgttggcggcctatcacccccaagatacacgcccgatgggaatggtcataaac
tatgaactgaatgactatctctgccgtctcttcgaattaggaagccaattgcccgtcctt
accgacaagatatttgctccccatacggaagtattccaaggcatgagctacagtatcaaa
gacggaaagaaggaaggagaactgcctgttcttgaagtgaaaaaaggtagccatcgctta
ctggcgagtcctttctccaatacggttatcttcaataagaaagcgattgatctgtcttcc
gtagtagtctatgtagataagactaagactttctatttgcctcgtgaactgcgttcttta
ttcggagaataa

DBGET integrated database retrieval system