KEGG   Porphyromonas gingivalis W83: PG1136Help
Entry
PG1136            CDS       T00145                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PG1136
Enzymes [BR:pgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PG1136
Peptidases [BR:pgi01002]
 Cysteine Peptidases
  Family C44
   PG1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1216789..1218417)
Genome map
AA seq 542 aa AA seqDB search
MKIVSDFTLVLPNKDIDISVGYSAGFIFDGNRHLTSQELQAFFQEASDWDDFLSRAKRIT
GEWAVVFQRAEGEVWAATDHRSSQRLYFRLAADGLRMAENGYSLFTERDSWDGDAVLFFL
RWGYTPADSTLIREIRKLPPGHALRYRVGEGITTTAYDTVDRYAPFDSHLLSYEEAKEEL
KHRLILAGKRLVRYLNGRSAILPLSGGFDSRMIAYMLHRLKYPHVYCISYGKEENPDSLK
AAKVADKLGFPFVYINSVRPDRSDYTQDAEFLSYMYNMTGLSSCYYYQEFIAAASIASGS
VHNGMVSFPSNAVVLPGHQGDDLGGSQLMYSRLAESKLSPNELSRILYSHKQMNQQFDRK
QKERLLSIQAKLFSSYDKEQQPAYRTFEQYMQWENIPKYMLNSQQSWRFFGLDTVCMLLD
KELLDFAYSLPFEYRYGKRIYDDICRELYGEKGISFSDDLNLHGIISSPVYRLKRSLKPL
LRPFIPRPSIWKGDIIGFERIMQPVLRQVEQDGRFHPTSINGLSFCWYLLQNEKLIDRPL
PL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtctcagacttcactcttgtgcttcctaataaagatattgatatatcagtc
ggttattccgcaggttttatttttgatggaaacagacatctcacatcccaagagctgcaa
gccttttttcaggaggcatcggattgggatgacttcctttcccgagctaagcgtattaca
ggagaatgggctgtcgtattccaacgtgccgaaggcgaagtctgggctgccaccgaccat
cgctcttctcagagactctatttccgtcttgcggcggacggactccgtatggcagaaaac
ggttactcactgttcaccgagcgagatagctgggatggtgacgctgttctctttttcttg
cgttggggttatacacctgctgatagcacattgatccgcgaaatacggaaacttcccccc
ggccatgccctacgctatagagtcggagagggtattacgaccactgcctatgacacagta
gaccgatatgccccgtttgacagccatcttttatcttatgaagaggctaaagaggaactg
aagcaccgccttattcttgccggcaagagactcgttcgctacctgaatggcagatcggcc
atacttcccctttccggaggattcgactcgcggatgatagcctacatgctgcatcgtctg
aagtacccacatgtctattgtatctcctatggcaaagaggaaaatcctgatagcttgaaa
gctgctaaagtggcggacaaactcggctttccattcgtctatatcaacagtgtacgaccc
gatcgttccgactatacgcaggatgctgagttcctgtcttatatgtacaacatgaccgga
ctatcctcctgctattactaccaagagttcatcgcggctgcaagtatcgcgtccggatca
gtgcacaacggtatggtttcattcccatcgaatgctgttgttttacccggtcatcaggga
gacgatttgggtggttcacagctgatgtattcccgtttggcagaaagcaaactttcgccc
aacgagctgtcgcgtatcctctactcccacaagcagatgaatcagcagttcgacaggaag
caaaaggaacgattactatccatacaggcaaagctgttttcctcctacgacaaggaacaa
caacctgcttatcgcactttcgagcagtatatgcagtgggaaaacatccctaagtatatg
ctcaacagccagcaatcatggcgattcttcggattagatacggtttgtatgcttctcgat
aaggaattgcttgactttgcctactctcttcccttcgaataccgctacggaaagcgtatc
tatgatgatatttgtcgtgaactgtatggcgagaaaggcatttctttttcggacgatttg
aacctgcatggcattatctcttctcctgtttaccgactcaaacgatctctaaagcctttg
cttcgaccatttataccccgtccttcgatttggaaaggcgatattatcggttttgaacgg
atcatgcaacctgtattacgacaggtagagcaagacggacgtttccacccgacatctata
aatgggttatccttctgctggtatctgcttcaaaacgaaaaattgattgaccgccctctg
cctctctga

DBGET integrated database retrieval system