KEGG   Porphyromonas gingivalis W83: PG1136Help
Entry
PG1136            CDS       T00145                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pgi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1216789..1218417)
Genome map
AA seq 542 aa AA seqDB search
MKIVSDFTLVLPNKDIDISVGYSAGFIFDGNRHLTSQELQAFFQEASDWDDFLSRAKRIT
GEWAVVFQRAEGEVWAATDHRSSQRLYFRLAADGLRMAENGYSLFTERDSWDGDAVLFFL
RWGYTPADSTLIREIRKLPPGHALRYRVGEGITTTAYDTVDRYAPFDSHLLSYEEAKEEL
KHRLILAGKRLVRYLNGRSAILPLSGGFDSRMIAYMLHRLKYPHVYCISYGKEENPDSLK
AAKVADKLGFPFVYINSVRPDRSDYTQDAEFLSYMYNMTGLSSCYYYQEFIAAASIASGS
VHNGMVSFPSNAVVLPGHQGDDLGGSQLMYSRLAESKLSPNELSRILYSHKQMNQQFDRK
QKERLLSIQAKLFSSYDKEQQPAYRTFEQYMQWENIPKYMLNSQQSWRFFGLDTVCMLLD
KELLDFAYSLPFEYRYGKRIYDDICRELYGEKGISFSDDLNLHGIISSPVYRLKRSLKPL
LRPFIPRPSIWKGDIIGFERIMQPVLRQVEQDGRFHPTSINGLSFCWYLLQNEKLIDRPL
PL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtctcagacttcactcttgtgcttcctaataaagatattgatatatcagtc
ggttattccgcaggttttatttttgatggaaacagacatctcacatcccaagagctgcaa
gccttttttcaggaggcatcggattgggatgacttcctttcccgagctaagcgtattaca
ggagaatgggctgtcgtattccaacgtgccgaaggcgaagtctgggctgccaccgaccat
cgctcttctcagagactctatttccgtcttgcggcggacggactccgtatggcagaaaac
ggttactcactgttcaccgagcgagatagctgggatggtgacgctgttctctttttcttg
cgttggggttatacacctgctgatagcacattgatccgcgaaatacggaaacttcccccc
ggccatgccctacgctatagagtcggagagggtattacgaccactgcctatgacacagta
gaccgatatgccccgtttgacagccatcttttatcttatgaagaggctaaagaggaactg
aagcaccgccttattcttgccggcaagagactcgttcgctacctgaatggcagatcggcc
atacttcccctttccggaggattcgactcgcggatgatagcctacatgctgcatcgtctg
aagtacccacatgtctattgtatctcctatggcaaagaggaaaatcctgatagcttgaaa
gctgctaaagtggcggacaaactcggctttccattcgtctatatcaacagtgtacgaccc
gatcgttccgactatacgcaggatgctgagttcctgtcttatatgtacaacatgaccgga
ctatcctcctgctattactaccaagagttcatcgcggctgcaagtatcgcgtccggatca
gtgcacaacggtatggtttcattcccatcgaatgctgttgttttacccggtcatcaggga
gacgatttgggtggttcacagctgatgtattcccgtttggcagaaagcaaactttcgccc
aacgagctgtcgcgtatcctctactcccacaagcagatgaatcagcagttcgacaggaag
caaaaggaacgattactatccatacaggcaaagctgttttcctcctacgacaaggaacaa
caacctgcttatcgcactttcgagcagtatatgcagtgggaaaacatccctaagtatatg
ctcaacagccagcaatcatggcgattcttcggattagatacggtttgtatgcttctcgat
aaggaattgcttgactttgcctactctcttcccttcgaataccgctacggaaagcgtatc
tatgatgatatttgtcgtgaactgtatggcgagaaaggcatttctttttcggacgatttg
aacctgcatggcattatctcttctcctgtttaccgactcaaacgatctctaaagcctttg
cttcgaccatttataccccgtccttcgatttggaaaggcgatattatcggttttgaacgg
atcatgcaacctgtattacgacaggtagagcaagacggacgtttccacccgacatctata
aatgggttatccttctgctggtatctgcttcaaaacgaaaaattgattgaccgccctctg
cctctctga

DBGET integrated database retrieval system