KEGG   Porphyromonas gingivalis W83: PG1160Help
Entry
PG1160            CDS       T00145                                 

Definition
L-threonine-O-3-phosphate decarboxylase
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PG1160
Enzymes [BR:pgi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.81  threonine-phosphate decarboxylase
     PG1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1239071..1240078)
Genome map
AA seq 335 aa AA seqDB search
MIKGHGDDLYRHGPIRANFSSNVYNATERQGLLDHLHRRLDSIGSYPEPEPYSLEKGLAD
YHGIAADSISVTSGATEAIYLIAQAFRGSSSAVVVPTFSEYADACRLHGHRVDFISKPEE
ASSRYDMVWLCNPNNPTGRVWKTSELYRIVRECPSTIFIVDQSYEYFSIAEVLDTKEAVS
LPNLLLLHSLTKRFAIPGLRLGYLTAHASLTERIRVCRMPWSVNALAIAAGEYLVQQGFP
TSIPLAELRVETERLRTAIGSMAGYEVEPTDTHFMLVRCRHHSAADLKAVLADQYGLLIR
DASNFEGLDTHCIRIATQTREQNDWLIDALRSISF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaggacacggagatgacctctaccgtcacggccccattcgggcaaatttcagt
tcgaatgtttataacgccaccgagcgtcagggattgctggatcaccttcacaggagattg
gatagcatcggttcctatccggagccggagccttattctttggagaaaggtttggccgat
tatcacggtatagctgccgattcaatcagtgtgaccagcggtgccaccgaagctatttat
ctcatagcgcaggctttccgtggatcttcttcagccgtagtagttcccactttcagcgaa
tatgccgatgcttgccggctgcatggccatcgtgtggattttatttccaagcccgaagag
gcttcttctcgatatgatatggtctggctctgtaatccgaacaatccgacgggacgtgtt
tggaagacaagcgagttgtatcgtatcgttcgggagtgtccgtccacgatttttattgtg
gatcagtcttacgagtacttttctatagccgaagtcctcgatacgaaagaggcggtttct
ctccccaatcttttgctgctgcattcgcttaccaagcgttttgcaataccgggcttacgc
ctcggatacctgacagcacacgcttctctgaccgaaaggatcagagtttgccgcatgcca
tggtcggtgaatgctcttgccattgctgccggtgagtatctggtgcaacagggatttccc
acttctatacctttggccgaactacgtgtggaaaccgaacggctacgcacggctatcggc
tcaatggccggttatgaggtggagccgactgatacccatttcatgctggttcgctgccgt
catcattcagccgccgatctgaaagctgttttggccgatcaatacggtctgctgattcgg
gatgcctccaactttgagggcttggatacccattgcattcgtatagctacacagacacgt
gagcagaacgattggctgatcgatgcacttcgatcgatttctttctaa

DBGET integrated database retrieval system