KEGG   Porphyromonas gingivalis W83: PG1371Help
Entry
PG1371            CDS       T00145                                 

Definition
phosphorylase
Orthology
K00757  
uridine phosphorylase [EC:2.4.2.3]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PG1371
Enzymes [BR:pgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     PG1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1452442..1453320)
Genome map
AA seq 292 aa AA seqDB search
MKTKRTIPPSELIINTDGSVFHLHIRPEQLADKVILVGDPARVDAVASRFERIECNVSNR
EFHTVTGWYGDKRITVQSHGIGSDNIDIVLNELDALANIDFDTRQVKDRLRKLTLVRVGT
SGGLQDNTPIGSYVAAERSIGFDGVMYFYSDTEKIRDAAFEAALQDQLEWKIEGLKPYVI
PADKTLSDRICREDILRGVTIAANGFYGPQGRRLRLPLKDEDLNRKIQAFDFNGSRITNY
EMESSSLAGLAALMGHEAITVCCIIAGRKSEKMNTSYQGSIEGLIDLVLERI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaaagaacgattcccccctccgagctgatcatcaatacggacggttcggtc
tttcatctgcatattcgtcccgaacaattggccgataaggtcatattggtaggtgatcct
gctcgagtggatgcagtcgcctctcgtttcgagcgtattgaatgcaatgtatccaatagg
gagtttcataccgtcacggggtggtatggcgacaagcgtatcacggtgcagagccacggc
atcggctctgataatatagatatagtcttgaacgaactggatgctctggccaatatagac
ttcgatacccgccaggtgaaggatcggctacgcaaactcacactcgtaagggtggggact
tcgggcggattgcaggacaatacgcccataggatcttatgtggctgcagagcgaagcatc
ggcttcgatggagtcatgtatttctatagcgatacggagaagatacgggatgcggccttc
gaagcagcacttcaggatcaactggagtggaaaatcgaagggctgaaaccctacgtgata
ccggctgacaagacgctgtcggatcgaatatgtcgggaggacatcctgcgaggtgtgact
attgcagccaatggcttctacggaccgcaggggcgtcgcttgcgcttacccctcaaagac
gaggatctgaacaggaagatacaggctttcgacttcaatggcagccgtattacgaactat
gaaatggaaagctcctctttggccggtctggctgccctgatggggcacgaagccatcacg
gtctgttgtatcatcgcaggcaggaaatccgaaaagatgaatacctcctatcagggaagt
atagagggccttatcgatttggttctggaacgtatctga

DBGET integrated database retrieval system