KEGG   Porphyromonas gingivalis W83: PG1632Help
Entry
PG1632            CDS       T00145                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgi00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1712408..1713475
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFASCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIIYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARHYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCGRCVSPKTGIVLDVYSTEPGMQVYTGNWMSG
KLRGKSDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttgcctcctgcctgaatggtaaggat
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gctcgaatcgttgccctcatcgtgccggacaaagatggcaatcggacggacgtcgtcctg
gggcacgactccctacaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcatttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctactgcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggcattatctccccacagacgatacggccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcggccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattccaccgaaccgggtatgcaggtgtacacgggcaactggatgagcgga
aagctgagggggaagtccgatcggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system