KEGG   Porphyromonas gingivalis W83: PG1632Help
Entry
PG1632            CDS       T00145                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PG1632 (galM)
   00052 Galactose metabolism
    PG1632 (galM)
Enzymes [BR:pgi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PG1632 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1712408..1713475
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFASCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIIYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARHYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCGRCVSPKTGIVLDVYSTEPGMQVYTGNWMSG
KLRGKSDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttgcctcctgcctgaatggtaaggat
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gctcgaatcgttgccctcatcgtgccggacaaagatggcaatcggacggacgtcgtcctg
gggcacgactccctacaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcatttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctactgcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggcattatctccccacagacgatacggccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcggccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattccaccgaaccgggtatgcaggtgtacacgggcaactggatgagcgga
aagctgagggggaagtccgatcggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system