KEGG   Porphyromonas gingivalis W83: PG1793Help
Entry
PG1793            CDS       T00145                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PG1793 (glgB)
Enzymes [BR:pgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PG1793 (glgB)
Exosome [BR:pgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PG1793 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884062..1886068
Genome map
AA seq 668 aa AA seqDB search
MRIIEQDPWLRPYESVIESRLKYARKRETDLTGGRSGGLSDFANGHLYYGLHQDGDSWVI
REFAPEATAVYLIGELSRWRRLPQFRFAPVDEAGSWELRLSCRLLPHGSRYRLFFEWPGG
EGERIPAWCNRVEQDPETYLFYAQVWVPDTPYEMKHPHPNRKDEPLLIYECHIGMSSEEE
KVSTYEEFRRNILPRICKDGYNAIQLMAIQEHPYYASFGYHVSSFFAPSSRFGTPEDLKR
LIDEAHALGLYVIMDLVHSHAVKNEVEGLGLYDGTHTLFFHDGNRGLHPAWDSYCFDYGR
DNVLHFLLSNCKYWLTEFGFDGFRFDGVTSMLYYSHGLGDRFDNYDSYYNGHQDGDAIAY
LILANKLIHELCPDAITIAEEVSGMPGLALPLADGGYGFDYRLAMNIPDFWIKLIKEHRD
EDWNPGDIWYQLTNRRQEEKTISYAESHDQALVGDKTIIFRLIDADMYWYMNKQSCVHSV
DRGIALLKMIRLFTATTMNGGYLNFMGNEFGHPEWIDFPREGNGWSYKYARRQWSLADSP
FLRYAGLHLFDQDMIAMIRSVESFHKLPLREYWLKREEQVICYGRGDFFFVFNFHPERSY
SDYPIPLPAGKYSVAMSTDARKYEGFGRVDEWVEHFTLPDGSKDRFTHEQYLNLYLPARS
ALVLKLAE
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagaataatcgaacaagatccttggctgcgcccatatgaatcagtaatagaaagcaga
ctgaagtatgctcgcaaacgagagacggatttgaccggaggaagatccggaggattgagc
gacttcgccaatggacatctctattacggtcttcatcaggacggggattcgtgggtgatt
cgtgagttcgcgcccgaagccacggccgtatatctgatcggcgaactttcgcgctggcgt
agattgccacagtttcggtttgcgcctgtggatgaagcgggttcatgggaattgcgactt
tcatgccgactgcttccgcatggctctcgctacaggctcttcttcgaatggcccggtggc
gaaggagagaggataccggcttggtgcaaccgtgtagaacaggatcctgaaacttatctt
ttctacgcccaagtgtgggtgccggatactccctatgaaatgaaacaccctcatcctaac
cgtaaggacgagcctttgctaatttatgaatgtcatatcgggatgtcgtccgaggaggag
aaggtcagcacatacgaagagtttcgacggaatatcctcccccgtatctgcaaggacggc
tataatgccatacagctcatggcgatacaggagcatccttattacgcgtcgttcggctat
catgtgtcgagtttctttgctccgagcagtcgttttggaacgcccgaagatctcaagcgt
ctgattgatgaagcccacgctctcggcctctacgtgatcatggatctggtgcattcgcat
gcagtcaagaacgaggtcgaaggcttgggcttgtatgacggcacgcatacccttttcttc
catgacggcaatcgcggactccatccggcttgggattcgtattgcttcgactatggtagg
gacaacgtactgcacttcctcctttccaactgcaaatactggctgacagagtttggattc
gacggcttccgtttcgatggtgtgacgtccatgctatactatagtcatggactcggcgat
aggttcgacaattacgacagctattacaacggccatcaggacggcgatgctattgcctat
ctgatcttggccaacaaactcattcacgaactttgccccgatgcaatcacgatagccgaa
gaggtaagcggcatgcccggattagctcttcccttggcagatgggggatatggctttgac
taccgtttagccatgaatatccccgatttctggatcaagctcatcaaagagcatcgtgac
gaagactggaatcccggcgacatctggtatcaactgaccaatcgccgtcaggaggaaaag
acgatcagctatgccgagagtcacgatcaggctttggtcggggacaagacaatcatattt
cgcctgatcgatgccgatatgtattggtatatgaacaagcagagttgtgtacatagcgtg
gacagaggcattgcactgctgaagatgatccgtctcttcactgccacgacgatgaatggt
ggttatctcaatttcatgggcaatgaattcggacatcccgagtggatagacttccctcgc
gaagggaatggctggtcgtacaagtatgcccgcaggcagtggagtctggccgatagtcct
ttcttgcgctatgcaggtctgcacttgtttgatcaggatatgatagccatgatacgatcg
gtggagagctttcacaaactccctttgcgcgaatactggctcaagagagaagagcaggtg
atctgttacggtcgaggcgatttcttcttcgttttcaattttcaccccgaacgttcttat
tcggattatcccatccctcttccggccggtaagtattcggtagcgatgagtaccgatgca
cggaagtacgaaggtttcggtcgtgtggacgaatgggtggagcactttactcttccggat
gggagtaaagatcggtttacccatgaacagtatttgaacctctatctgccggctcgctct
gctctcgtcctgaagcttgccgaatga

DBGET integrated database retrieval system