KEGG   Porphyromonas gingivalis W83: PG2159Help
Entry
PG2159            CDS       T00145                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pgi  Porphyromonas gingivalis W83
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pgi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2264537..2265934
Genome map
AA seq 465 aa AA seqDB search
MDHLTVIIGAGLTGLTTAAFLRAAGRPVLVLERAAHIGGQIRTYREDGFVFETGPNTGTI
SSPEVAELFELLGLEPEIATPAASNRLIWKGNKLYPLPRNIAEAVATPLFSLWDKWRILG
EPFRRRGGQPNETVGALARRRLGKSFVDYAVDPFLGGIYAGDPDQLVTRFALPKLYDLEQ
RYGSFVLGAVRKARQPQSERDRKASRKVFSVQGGLGLLVEALADYIGREHILTETQIRYI
NHPGAHTFGLTYTDASEEEHTIPCRHLVSTVAAHHIPTLFDHFPADESAVFEQLYYAPMI
EVAVGFRRNVATHLPAFGCLIPSRENRRILGILFPSDCFRGRAPEGGALYSIFMGGVRNA
SLIDLSDEEISTIAMEELRDMLRIPHTCKPDLLHISRHRHAIPQYYADTELRQDIIRRME
MRWPGLHLGGNMHGGIGMAHRISQGVEMARSIIEETAIAERSARG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatcatctgaccgtcatcataggagccgggctcaccggactgaccacagccgctttc
ctcagagctgccggcaggcctgttctggttttggagcgagctgctcatatcggcggacag
atacgcacctacagagaggacgggttcgtgttcgagacagggccgaataccggcacgatc
tcctctccggaagtggccgagctattcgaactgctcggattggaacctgagatagccact
cctgcggcctctaaccgtctgatatggaaaggcaacaaactgtatccccttccaaggaac
atcgccgaggcagtcgctactcctctcttttccctgtgggacaaatggcgtatcctcggc
gaacccttccgccggagaggcggacaacccaatgagacggtcggagccttggctcgtcgc
cggctgggcaaaagttttgtggactacgcagtcgatcctttcctcggaggtatttatgca
ggagatcccgaccaactggttactcgctttgccctgcccaaactatacgatctggagcag
cgatacggcagcttcgtactgggtgccgttcgaaaagcccgacagccgcaaagcgaacgc
gaccgcaaagcctcgcgcaaggtcttttccgtacaagggggactcggtcttctggtcgaa
gctttggccgactacatcggacgcgaacacatcctgacggaaacgcaaatccgatacatc
aatcacccgggagcacacaccttcggccttacctatacggatgcttcggaagaggagcac
accattccttgccgccacttggtgagtacggtggcagcgcaccatatccccacactgttc
gaccacttccctgcggatgaatcagccgtgttcgagcagctctattatgcacccatgata
gaggttgccgtagggttccgccgaaatgttgccacacacctgccggctttcgggtgcctg
atcccttcgagggaaaatcgtcgcatcctcggcatcctgttcccttcggactgtttccgt
ggcagagcacctgaagggggcgcactctattccatattcatgggtggggtgcgaaatgct
tcgctcatagacctttccgacgaggagatcagcacgattgcaatggaagagctacgcgat
atgctgcgcatacctcacacctgtaagccggatctgctgcacatctcacgccaccgccat
gccataccgcaatactacgccgatacggaacttcggcaggacatcatccggcggatggaa
atgcgctggccgggcttgcatttgggtggcaatatgcatgggggaataggtatggcacat
cgtatctcacaaggtgtggaaatggctcgaagtatcatagaagagacagccatcgccgaa
cgctctgccagaggctga

DBGET integrated database retrieval system