KEGG   Porphyromonas gingivalis W83: PG_0272Help
Entry
PG_0272           CDS       T00145                                 

Definition
(GenBank) CBS domain protein
Organism
pgi  Porphyromonas gingivalis W83
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
304539..305798
Genome map
AA seq 419 aa AA seqDB search
MAFIIDLLLLCCSAFMSSCEVAYFSLKPIDLQNIRERNHSSDIALSNLLDNSNQLLATIL
IGNNVINVAIVILSNYAIEQTFVFSSPIIGFLIQTILLTTVLLLFGEILPKVYARKNPLQ
YSRFSAAAMSVIYKILSPFSKLLVKSTGIVTRGISKKKYDMSVDELSKAVALTTTEGEPE
EKEMINEIIKFYNKTACEIMVPRIDIVDVDLSWPFRKMLDFVVSSGYSRLPVSEGSEDNI
KGVIYIKDLIPHMDKGDEFDWHPLIRKAYFVPENKRIDDLLEEFRANKVHVSIVVDEFGG
TCGLITMEDILEEIVGEITDEYDEEELPFKVLGDGSYLFEGKTSLSDVRHYLDLPENAFG
ELGDEVDTLSGLFLEIKQELPHVGDTAVYEPFRFQVTQMDKRRIIEIKIFPFERTWEVE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggctttcattatcgacctgcttcttctttgctgttcggcttttatgtcctcctgtgag
gtggcttatttttcactaaagccgatcgatctgcagaacatccgcgaacggaatcactct
tccgacatcgcgctttccaatttattagacaattcgaatcagctattagctactattctg
atcgggaataatgtgattaatgtagccatcgttatcctttccaattatgccatcgagcag
acattcgttttctcttctccgatcattggatttctgatccagacgatactcctgaccact
gttcttttgctgttcggagagattctgccgaaagtgtatgcgcggaagaatccgctgcaa
tactcgcgcttttctgctgcagctatgtccgttatctataagatattgtcaccgttttca
aaattgctggtcaaaagtaccggcatcgttaccagaggtatcagcaagaagaaatacgat
atgtccgtggatgagctctcgaaagcggtagccctcaccactacggagggagagccggag
gagaaagaaatgattaacgaaatcatcaaattctataataagacagcctgcgaaatcatg
gttccgcgtatcgatattgtggatgtggatctgagctggccatttcgtaagatgcttgac
ttcgttgtttcgtcgggttattccagacttcccgtttcagaggggtcagaagacaatatc
aaaggggtgatttacatcaaagatctaatcccacacatggataaaggcgatgaattcgac
tggcatcctctgattcgtaaagcatattttgtccccgaaaacaagcgcatagatgatttg
ctcgaggagttcagagccaataaggtgcatgtctccatcgttgtggatgagttcggtggc
acttgcggactgatcacaatggaggacatattggaagagatcgtcggcgagattacggac
gagtacgatgaggaagaactcccctttaaggttttgggggatggcagttatcttttcgaa
ggaaaaacgtctctctccgatgttcgacactatcttgaccttccggaaaatgctttcggt
gaattgggggacgaggtagatacgctaagtgggctcttcttggaaatcaagcaggaactc
ccccatgtgggcgatacagcagtgtacgagccattccgctttcaagtgacccaaatggac
aagcgccgaatcatcgaaatcaagattttccctttcgagcgcacttgggaggtcgaatag

DBGET integrated database retrieval system