KEGG   Phaeobacter gallaeciensis 2.10: PGA2_239p0390Help
Entry
PGA2_239p0390     CDS       T02193                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pgl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pgl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA2_239:46488..47546
Genome map
AA seq 352 aa AA seqDB search
MPPASLSSFGSYPPHAHLPETAAGQLQWLDLENDHLRLRILNFGAITARLDLRAGDGWLP
MVLGYRDMAAYLGDPFYLGAIVGRVANRVGGAGFDLAGRRVALDANEGGNQLHGGTAGLG
RVFWDIRQVADDAVELRYTSADGENGYPGCAEIQLRIALSGGSVSYDMRASVDQPTPINL
AQHNYYTLGATGDIWEHRLQCPASTYLRLRPDGVPTGAIVPVAGTSFDFTDGQPFATLDP
QRRGTDNHVIFAKGAEGHMSEIAKLTSPNGVSMRVCSDQPGAQIYTATHLSSGPAAQEGQ
QLAPFAAVCIEPQGFPDAVNQPDFPSVIVHPGRPYHQRLSLDFSTNEADRDD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagccagcctgtcatcttttggatcatatccgccgcacgcgcatctgccggag
actgcggctggtcagctgcaatggctggatctggaaaatgatcatctgcggcttcggatc
ctcaacttcggcgcaattacggcacgtctggatctgcgcgccggtgatggatggttgcca
atggttctgggctatcgcgatatggccgcctatctcggggatcctttctatctgggggct
attgtgggtcgggtggccaatcgcgttggcggtgctggttttgatctcgcggggcggcgg
gttgcactggatgcaaatgagggtggaaatcagctgcatggagggacggcgggtctcggg
cgggtattctgggatatccggcaggtcgccgatgatgcggtggagctgagatatacctca
gctgatggtgagaatggctatcccggatgcgccgaaatccagctgcggatcgcattgtct
ggcggcagcgtcagctacgatatgagggccagtgttgatcagccgacaccaatcaacttg
gcgcagcacaattactacacgctgggtgccacgggtgacatttgggagcaccgtttgcag
tgtccggcatcaacctatctgcggctgcgcccggacggggtgccaacaggcgcgattgtg
cctgtcgcggggacctcgttcgattttaccgatgggcagccgtttgcaacgctggatcca
cagcgacgtggaaccgacaatcatgtcatctttgccaagggtgccgaggggcatatgtcg
gagatcgcgaagttgacttccccaaacggggtttccatgcgggtttgttcggatcagccg
ggtgcgcagatctatacggcaacacatctgagcagcgggccggcggcacaggaagggcag
cagcttgcacctttcgccgctgtctgtattgagccacaggggttcccggatgcggtcaat
caacctgattttccaagcgttattgtgcacccggggcggccttatcaccagaggctgtcg
ttggatttctcaacaaatgaggcagaccgggatgactga

DBGET integrated database retrieval system