KEGG   Phaeobacter gallaeciensis 2.10: PGA2_239p0390Help
Entry
PGA2_239p0390     CDS       T02193                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_239p0390
   00052 Galactose metabolism
    PGA2_239p0390
Enzymes [BR:pgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PGA2_239p0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA2_239:46488..47546
Genome map
AA seq 352 aa AA seqDB search
MPPASLSSFGSYPPHAHLPETAAGQLQWLDLENDHLRLRILNFGAITARLDLRAGDGWLP
MVLGYRDMAAYLGDPFYLGAIVGRVANRVGGAGFDLAGRRVALDANEGGNQLHGGTAGLG
RVFWDIRQVADDAVELRYTSADGENGYPGCAEIQLRIALSGGSVSYDMRASVDQPTPINL
AQHNYYTLGATGDIWEHRLQCPASTYLRLRPDGVPTGAIVPVAGTSFDFTDGQPFATLDP
QRRGTDNHVIFAKGAEGHMSEIAKLTSPNGVSMRVCSDQPGAQIYTATHLSSGPAAQEGQ
QLAPFAAVCIEPQGFPDAVNQPDFPSVIVHPGRPYHQRLSLDFSTNEADRDD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagccagcctgtcatcttttggatcatatccgccgcacgcgcatctgccggag
actgcggctggtcagctgcaatggctggatctggaaaatgatcatctgcggcttcggatc
ctcaacttcggcgcaattacggcacgtctggatctgcgcgccggtgatggatggttgcca
atggttctgggctatcgcgatatggccgcctatctcggggatcctttctatctgggggct
attgtgggtcgggtggccaatcgcgttggcggtgctggttttgatctcgcggggcggcgg
gttgcactggatgcaaatgagggtggaaatcagctgcatggagggacggcgggtctcggg
cgggtattctgggatatccggcaggtcgccgatgatgcggtggagctgagatatacctca
gctgatggtgagaatggctatcccggatgcgccgaaatccagctgcggatcgcattgtct
ggcggcagcgtcagctacgatatgagggccagtgttgatcagccgacaccaatcaacttg
gcgcagcacaattactacacgctgggtgccacgggtgacatttgggagcaccgtttgcag
tgtccggcatcaacctatctgcggctgcgcccggacggggtgccaacaggcgcgattgtg
cctgtcgcggggacctcgttcgattttaccgatgggcagccgtttgcaacgctggatcca
cagcgacgtggaaccgacaatcatgtcatctttgccaagggtgccgaggggcatatgtcg
gagatcgcgaagttgacttccccaaacggggtttccatgcgggtttgttcggatcagccg
ggtgcgcagatctatacggcaacacatctgagcagcgggccggcggcacaggaagggcag
cagcttgcacctttcgccgctgtctgtattgagccacaggggttcccggatgcggtcaat
caacctgattttccaagcgttattgtgcacccggggcggccttatcaccagaggctgtcg
ttggatttctcaacaaatgaggcagaccgggatgactga

DBGET integrated database retrieval system