KEGG   Phaeobacter gallaeciensis 2.10: PGA2_239p0400Help
Entry
PGA2_239p0400     CDS       T02193                                 

Definition
putative cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Brite
Enzymes [BR:pgl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PGA2_239p0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA2_239:47539..48891
Genome map
AA seq 450 aa AA seqDB search
MTEYWRRSGLLGSIVTSLSLWAYADEVIAEIKRQPLDLGPRPSFALMDQAQVELGQLLFY
DPILSGNRNISCASCHHPRFGTGDGVSLSLGEGASRLGPKRQADPENLPEQRIPRNAPAL
WNLGARGMDVMFHDGRLEADPAYGSGIRTPLEGDMVAGFDSALSAQAMFPVLSADEMAGH
YGENEVSRAVRLGQLSHPGGAWDLIAGRVADIPEYRQRFDRVLGQGASIQFTDIGNMLAA
FIRFEWRADDSPFDRAQMQGEPLLPAAARGQEAFYGAAGCSQCHSGWLQTDNGFHAIAMP
QLGPGKAARFEAHARDEGRLRVTGNADDAYRFRTPSLRNVALTAPYGHSGAYATLEAVVR
HHLNPLDALMSYDRSQAVLPALQEAIDWAAMDDPAEVQRIASANDLVPVMLSDDEVADLI
AFLEALTDSTAAAGRLGVPDAVPSGLPVER
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtattggcgtcggagcggccttctggggtctattgtcaccagcctgagcctt
tgggcctatgctgacgaggtgatcgcggagatcaagcgtcagcccttggatctgggtccc
cgtccgagtttcgcgctgatggatcaggcacaggtcgagttggggcagctgttgttctac
gatcccatcctgtcaggcaatcgcaatatcagctgcgccagctgtcaccatccgcggttt
ggcactggtgatggtgtgtcgctgtcgctgggggagggggcaagcaggcttggccccaaa
cgacaggccgatcccgaaaacctgccggagcaacgtatcccgcgcaatgcgcctgcactt
tggaaccttggcgcgcggggaatggatgtcatgtttcatgacggcaggctggaggcagat
ccagcctatggatcaggtattcgtacgccgctggagggcgatatggttgccgggtttgac
tcagcgttgtctgcgcaggcgatgtttccggtgctttcagcagatgagatggcaggccac
tacggcgaaaatgaggtgtcccgtgctgtgcgtctgggccagttgagccatccgggcggt
gcttgggatctgattgcaggtcgggtggcggatattccggaatacagacagcggtttgat
cgcgttttgggccaaggggcctccattcagttcacggatatcgggaatatgcttgcggcc
tttatccggtttgagtggcgggccgatgacagcccgtttgatcgtgcgcagatgcaggga
gaaccgctgctacccgccgctgcgcgggggcaagaggcgttttatggcgcggcgggatgc
agccagtgccattccggctggttgcagacggacaatgggtttcatgcaattgcaatgcct
cagcttggaccggggaaggccgcgcggtttgaggcccatgcccgcgatgaaggccggttg
cgcgtgaccggaaacgccgacgatgcgtataggtttcggacaccctcgctgcggaatgtg
gcgcttacggcgccctatgggcacagcggggcctatgccacgctggaggcggttgtgcgt
catcacttaaatccgctggatgctttgatgtcatatgatcgcagtcaggcggtcttgcct
gcacttcaggaggcaatcgattgggcggcaatggatgatcctgcggaggtgcagcgcatc
gcctccgccaatgatctggtgcccgtcatgttgagtgacgatgaggtcgccgatcttatc
gcctttctcgaggccctgaccgatagcacagcggcggcggggcggcttggtgtgccggac
gccgtgccctccgggctgcctgtcgagcggtag

DBGET integrated database retrieval system