KEGG   Phaeobacter gallaeciensis 2.10: PGA2_239p1890Help
Entry
PGA2_239p1890     CDS       T02193                                 

Definition
putative chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_239p1890
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PGA2_239p1890
Enzymes [BR:pgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PGA2_239p1890
Two-component system [BR:pgl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PGA2_239p1890
Bacterial motility proteins [BR:pgl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PGA2_239p1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA2_239:209833..210837
Genome map
AA seq 334 aa AA seqDB search
MSQSLLIITTDRRFAQTLQQHMEATYPGLQVLLANNLMMAYNQAEAGQPTFAFVEDGFTK
LPEFEMMLALFSALDIRWVSVMDNQGSTPARNSSPLLDVGAGIFELTKSDNPRDFARYFD
MMVKAPRRDQASPLQKQTAGGTAGPGSDKIILIGSSTGGVEALRSVLVGFPLNCPPTLIV
QHTGKNFGRGLVSLLDRICPAKVLTADDNMTLSPGHVYVAAGQPRHMGMTPRKPYRTRFK
EGPPISGHMPSVDALFMSAVPIAKSVVATILTGMGQDGAQGLLELRKAGAKTFAQDEKSS
VVYGMPRVAWEMGAAQQQVSLARMAGTLIQACKT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacagagcctattgatcatcaccacggaccggcgttttgcgcagaccctacaacaa
catatggaggccacctaccctggccttcaggtgcttttggccaacaatctgatgatggcc
tacaatcaggcggaggcgggtcagcccacttttgccttcgtcgaagatgggttcaccaaa
ctgcccgagttcgaaatgatgctggctctcttctcagcgcttgatatcaggtgggtgtct
gtgatggacaaccaggggtcaacgccagcgcgcaactcctcaccattgctggacgtcggg
gctggcatcttcgagctgacgaaatccgacaaccctcgcgattttgcgcgctatttcgac
atgatggtcaaggcgccgcgccgggatcaggcctcgcctttgcaaaaacaaaccgctggc
ggcacagcaggccccggcagtgacaagattatcctgatcggctcctccaccggcggtgtg
gaagccctgcgcagtgtgctggtcggatttccgctgaactgtccgccaaccctgatcgtt
caacacactggcaagaattttggccgcgggttggtttctcttctggatcgcatttgccca
gctaaggtattgactgccgacgacaatatgacgctgtcgcctggccatgtctatgtcgcg
gccggccagccacgccacatgggtatgaccccccgaaagccgtatcgtacgcggtttaag
gaaggtcccccaatctcaggtcatatgccgtctgtcgatgcactttttatgtctgccgtg
cccatcgcaaaaagcgttgttgccacaatcttaaccggtatggggcaagatggggcgcaa
gggctgctggagcttcgcaaggccggggcaaagacctttgcgcaggacgagaaaagcagc
gtcgtctacgggatgccacgcgttgcttgggaaatgggcgccgcacagcaacaggtctcg
cttgcgcgaatggccggaacactgattcaggcttgcaagacctga

DBGET integrated database retrieval system