KEGG   Phaeobacter gallaeciensis 2.10: PGA2_71p250Help
Entry
PGA2_71p250       CDS       T02193                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase RfbC (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PGA2_71p250 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA2_71p250 (rfbC)
Enzymes [BR:pgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PGA2_71p250 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPGA2_71:complement(36937..37572)
Genome map
AA seq 211 aa AA seqDB search
MCLSRGVTRVWALGQKTGPRQQIGGEGMQIEDTDLPGVKILTPARFGDARGFFCESWNKA
RMAEAGLDFDFVQDNHSLSMEVGTLRGLHFQAPPHAQAKLVRCGQGALFDVAVDIRKGSP
TYGRWTGVELSAANGRQLLIPAGFLHGFITRSPGTEVLYKCDAYYAPDCDGGVAWDSCGI
DWGFDGTPVLSEKDAAAPRFEDLDSPFVWEG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcccgtggcgtcacgcgcgtctgggcgttaggacagaagacaggaccacgg
cagcagatcgggggagagggcatgcagattgaagacacggacctgccaggggtgaagatc
ctgacaccggcgcggtttggcgatgcgcgggggtttttctgcgagagctggaacaaggcg
cggatggccgaggcggggctggatttcgatttcgtgcaggacaatcattcgctgtcgatg
gaggttggtaccctgcgcggtctgcattttcaggcgccaccccatgcccaggccaagctg
gtgcgctgcggccagggggcgctgtttgatgtggcggtggatatccgcaaaggctcgccc
acatacgggcgctggaccggggtggagctgtcggcggcaaatggccgtcagctgctgatc
ccggcggggtttctgcatgggttcatcacccgcagccccggcaccgaagtcctgtataaa
tgcgatgcgtattacgcgccggactgtgacggcggggtggcctgggacagctgcggtatt
gactggggcttcgacggtacaccggttctttctgaaaaggatgctgcggcgccccggttt
gaagacctcgacagccccttcgtgtgggaaggataa

DBGET integrated database retrieval system