KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c00550Help
Entry
PGA2_c00550       CDS       T02193                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase PncA (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pgl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58797..59402
Genome map
AA seq 201 aa AA seqDB search
MTKALIVIDVQMDFCPGGALAVPDGDQVVAPINAMMAQYDAVLMTQDWHPGDHSSFASQH
RDAAEYDMIEMPYGPQVLWPDHCVIDSAGAQFHPDLDLRGDLILRKGYRREIDSYSAFFE
NDQSTATGLHGYLQERGISDVTLVGLATDFCVAFSALDAARLGYDVTVDLTACRAIDLDG
SLAAAISKMQTAGVHLRDALG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagccttgatcgtgattgatgtgcagatggacttttgcccgggcggcgctctg
gcggtgccggatggggatcaggttgtggccccgatcaatgcgatgatggcgcaatatgat
gcggttctgatgacccaggattggcatcccggcgaccacagctcgtttgcctcgcaacat
cgcgatgccgccgaatatgatatgatcgagatgccctatggcccacaggtcctgtggccg
gatcactgtgtgatcgacagcgcaggcgcccagttccatccggatctggacctgcgcggg
gatcttatcctgcgcaaaggttaccggcgtgagatagacagctattcggcgttctttgag
aatgaccagagcacggcaaccggcttgcacggttacctgcaggaacgcgggatttcggat
gtgacgctggttgggctggcgactgatttctgcgttgccttctctgcgctggatgccgcg
cggctgggatatgatgtgacggttgacctgacggcctgccgggcgattgatctggatggg
tcactggcggcggccatatcgaagatgcagacagctggcgtgcacctgagggatgccctt
gggtaa

DBGET integrated database retrieval system