KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c00670Help
Entry
PGA2_c00670       CDS       T02193                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pgl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73450..74934
Genome map
AA seq 494 aa AA seqDB search
MTYILAIDQGTTSTRAILFDDRMQAQGSAQQEFAQHFPQAGWVEHDPEDLWTTTLDVCRK
VMAEQGVTAADIAGIGITNQRETTVVWDRHSGKPIHNAIVWQDRRTSPICEELRAAGHED
SVRQKTGLLLDPYFSGTKLKWILDTVPDARARAEAGDLLFGTVDSFLIWRLTGGASHVTD
ATNAARTLMYDIRKGRWSSEICGFLGVPRGMLPEVKDCAADFGTTKGEFLGGEIAILGVA
GDQQAATIGQACFQPGMMKSTYGTGCFALLNTGDTPVVSQNRMLTTIAYQLDGAPTYALE
GSIFIAGAAVQWLRDGLGIIGSAQESGALARNADPGQDVILVPAFTGLGAPYWKPDCRGG
MFGLTRNSGPAEFARAALQSVAYQTRDLWEAMRADWQGESLVTLRVDGGMSASNWTMQSL
ADLLGAAVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAETWALDQQFTPEMDEDRRSAA
YARWKRAVDAVIGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatattctggcgatagatcagggcacaacctcgaccagagcgatcctgtttgat
gacaggatgcaggcgcagggctcggctcagcaggagtttgctcagcatttcccgcaggcg
ggctgggtagagcatgatcctgaggatctgtggaccacaacgctggatgtctgccgcaag
gtgatggcagagcagggcgtcacggcggcggatattgccgggatcggcatcaccaatcag
cgtgaaaccacggtggtctgggatcgtcacagcggcaaaccgatccacaacgccattgtc
tggcaggaccgtcgcaccagcccgatctgcgaagagctgcgggcggcaggacatgaggac
agcgtgcgccagaaaaccggactgctgctggatccctatttctcgggcaccaagctgaaa
tggattctggacaccgtgccggatgcccgcgcccgcgctgaggccggggatctgttgttc
ggcactgtcgacagtttcctgatctggcgcctcacgggcggtgcgtcccatgtgacggat
gccaccaatgcggcgcggacgctgatgtatgacatccgcaagggccgctggagcagcgag
atctgcggcttccttggcgtgccgcgcggaatgctgcccgaggtgaaggattgcgccgcc
gattttggcaccaccaaaggtgaatttcttggtggtgaaattgccattctgggcgttgct
ggcgatcagcaggcggccaccatcggacaggcctgtttccagccgggtatgatgaaatcg
acctatggcacgggctgtttcgcgctgctgaacaccggtgatacgccggttgtgtcgcaa
aaccggatgctgaccaccattgcctatcagctggacggcgcgccgacctatgcgttggaa
ggctcgatctttatcgccggcgcggcggtgcaatggctgcgggacggcttgggcattatc
ggctcagcccaggaaagcggtgccctggcgcgcaatgcggatcccggtcaggacgtcatt
ctggtgccggcctttaccgggttgggtgcgccttattggaaacccgattgccggggcggc
atgtttggcctgacccgcaactcgggaccggcggaatttgcacgcgcagcactgcaaagc
gtggcctatcagacccgtgacctgtgggaggcgatgcgggcggattggcaaggcgagagt
ctggtcaccttgcgggtggatggcggcatgagtgccagcaattggaccatgcagagcctg
gcggatctccttggggcggcagtggatcgtccggtgatgcaggaaaccaccgcgttgggt
gcggcctggctggcggggatgcgggcgggggtctacccggatcaggcgggctttgctgag
acttgggcgctggaccagcaattcaccccggagatggacgaagaccgacgcagcgccgcc
tatgcgcgatggaagcgtgcggtagacgcggtgatcggggtctga

DBGET integrated database retrieval system