KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c00700Help
Entry
PGA2_c00700       CDS       T02193                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PGA2_c00700
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_c00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77205..77669)
Genome map
AA seq 154 aa AA seqDB search
MKLLTAVAALGLIAAPAFAEGDADKGEKGFNKCKSCHMVVSDSGDVIVKGGKTGPNLWGV
VGRTAGTYEGYKYGKDMVAAGEAGLAWDEASFTAYTADPKAFLRDTLGDKKAKSKMSFRL
KKGAEDIYAFLALHGPADAAETEAETTTEETATN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctgactgctgtagcagccctgggcctgattgcggcccctgcctttgccgaa
ggcgacgccgacaagggcgaaaagggcttcaataaatgcaaatcctgccacatggttgtc
tccgacagcggtgacgtgatcgtcaagggcggcaagaccggcccgaacctctggggcgtc
gtgggccgcaccgccggcacctatgagggctacaaatacggcaaggacatggtcgctgcg
ggcgaagcaggcctggcctgggacgaagcctccttcaccgcctataccgccgaccccaaa
gccttcctgcgtgacaccctcggcgataagaaagccaagtccaaaatgtccttccgcctg
aagaaaggcgcggaagatatctacgcattcctcgcgctgcatggtcctgcggatgctgcc
gaaaccgaggcagagaccaccacggaagagaccgcaaccaactaa

DBGET integrated database retrieval system