KEGG   Phaeobacter inhibens 2.10: PGA2_c00700Help
Entry
PGA2_c00700       CDS       T02193                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl01100  Metabolic pathways
pgl01120  Microbial metabolism in diverse environments
pgl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_c00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AFO86095
UniProt: I7EKM0
Position
complement(77205..77669)
Genome map
AA seq 154 aa AA seqDB search
MKLLTAVAALGLIAAPAFAEGDADKGEKGFNKCKSCHMVVSDSGDVIVKGGKTGPNLWGV
VGRTAGTYEGYKYGKDMVAAGEAGLAWDEASFTAYTADPKAFLRDTLGDKKAKSKMSFRL
KKGAEDIYAFLALHGPADAAETEAETTTEETATN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctgactgctgtagcagccctgggcctgattgcggcccctgcctttgccgaa
ggcgacgccgacaagggcgaaaagggcttcaataaatgcaaatcctgccacatggttgtc
tccgacagcggtgacgtgatcgtcaagggcggcaagaccggcccgaacctctggggcgtc
gtgggccgcaccgccggcacctatgagggctacaaatacggcaaggacatggtcgctgcg
ggcgaagcaggcctggcctgggacgaagcctccttcaccgcctataccgccgaccccaaa
gccttcctgcgtgacaccctcggcgataagaaagccaagtccaaaatgtccttccgcctg
aagaaaggcgcggaagatatctacgcattcctcgcgctgcatggtcctgcggatgctgcc
gaaaccgaggcagagaccaccacggaagagaccgcaaccaactaa

DBGET integrated database retrieval system