KEGG   Phaeobacter inhibens 2.10: PGA2_c02990Help
Entry
PGA2_c02990       CDS       T02193                                 

Gene name
phaA
Definition
(GenBank) acetyl-CoA acetyltransferase PhaA
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGA2_c02990 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    PGA2_c02990 (phaA)
   00640 Propanoate metabolism
    PGA2_c02990 (phaA)
   00650 Butanoate metabolism
    PGA2_c02990 (phaA)
  Lipid metabolism
   00071 Fatty acid degradation
    PGA2_c02990 (phaA)
   00072 Synthesis and degradation of ketone bodies
    PGA2_c02990 (phaA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGA2_c02990 (phaA)
   00310 Lysine degradation
    PGA2_c02990 (phaA)
   00380 Tryptophan metabolism
    PGA2_c02990 (phaA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGA2_c02990 (phaA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PGA2_c02990 (phaA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA2_c02990 (phaA)
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGA2_c02990 (phaA)
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGA2_c02990 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(330145..331320)
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFGGAFAKTPAHDLGAAVLQAVVERAGIDKSEVSETILGQVLTAA
QGQNPARQAHINAGLPQESAAWSLNQVCGSGLRAVALAAQHIQLGDAAIVCAGGQENMTL
SPHAANLRAGHKMGDMSYIDTMIRDGLWDAFNGYHMGQTAENVAEKWQISREMQDEFAVA
SQNKAEAAQKAGKFADEIAAFTVKTRKGDIIVDQDEYIRHGATIEAMQKLRPAFAKDGSV
TAANASGLNDGAAATLLMSADDAEKRGIEPLARIASYATAGLDPSIMGVGPIYASRKALE
KAGWSVDDLDLVEANEAFAAQACAVNKDMGWDPAIVNVNGGAIAIGHPIGASGCRVLNTL
LFEMKRRDAKKGLATLCIGGGMGVAMCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactaatgtagtaattgcatccgccgcacgcaccgccgtcggcagctttggtggcgca
ttcgccaagacccccgcacatgacctcggcgccgcggtgctgcaagctgttgtcgaacgc
gccgggatcgacaaatccgaagtctcagagaccattctgggccaagtgctgactgcagcg
cagggtcagaacccagcccgccaggcacatatcaacgctgggctccctcaggaatccgcg
gcttggagcctcaaccaggtctgcggatcggggctgcgggccgtggcattggctgcacag
cacattcagttgggcgacgctgccatcgtctgcgcgggcggtcaggaaaatatgacactc
tcgccgcatgctgcaaatcttcgtgctggtcacaagatgggcgatatgagctatatcgat
accatgatccgcgatggcctttgggacgctttcaacggctaccatatgggccagaccgct
gagaatgttgctgaaaaatggcagatctcccgcgagatgcaggatgaattcgccgttgcc
agccagaacaaggccgaagcggcacagaaggcgggcaaattcgccgatgaaatcgcagcc
ttcaccgtcaagacccgtaagggcgatatcattgtggatcaggatgaatacatccgccat
ggtgctacgatcgaagccatgcaaaaactgcgccccgccttcgccaaggatggttcggtc
accgccgccaatgcctccggcctcaatgatggtgccgccgctactctgctgatgagtgcg
gatgacgccgaaaagcgcggcatagagcctctggcgcggattgcctcctatgccaccgcg
gggctggatccgtctatcatgggtgtcggcccgatctacgcctcccgtaaggcactggaa
aaggcaggctggtccgttgatgaccttgatctggtggaggcgaacgaagccttcgcagcc
caggcctgcgccgtgaacaaggatatgggctgggatccagcaatcgtgaacgtcaacggc
ggcgccatcgccattggtcacccgattggggcctctggttgccgggttctcaatacgctg
ctgttcgaaatgaagcggcgcgacgcaaagaaagggctggcaaccctttgcattggtggc
ggcatgggtgtcgccatgtgcgtggagcgcccctga

DBGET integrated database retrieval system