KEGG   Phaeobacter inhibens 2.10: PGA2_c03160Help
Entry
PGA2_c03160       CDS       T02193                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
pgl00020  Citrate cycle (TCA cycle)
pgl00310  Lysine degradation
pgl01100  Metabolic pathways
pgl01110  Biosynthesis of secondary metabolites
pgl01120  Microbial metabolism in diverse environments
pgl01130  Biosynthesis of antibiotics
pgl01200  Carbon metabolism
Module
pgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA2_c03160 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PGA2_c03160 (sucB)
Enzymes [BR:pgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PGA2_c03160 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFO86336
Position
complement(347046..348596)
Genome map
AA seq 516 aa AA seqDB search
MTTEVRVPTLGESVTEATVATWFKKPGDAVAADEMLCELETDKVTVEVPAPAAGTLGEIV
AAEGETVGVDALLATIAEGGSDTAAAPATSAPAATKDAAKGDAGAATDVMVPTLGESVSE
ATVSTWFKKVGDSVAQDEMLCELETDKVSVEVPAPTAGILTEITAEEGSTVDATAKLGVI
SGGEAGAVTPTPTKGETADGAQYTTPPAGQGDPAKDIANAPSAEKAMAEAGLSADQVQGS
GRDGRIMKDDVARAVAAAAAAPATSTSTPAAATPVRAPVAADDAAREERVKMTRLRQTIA
KRLKDSQNTAAMLTTYNEVDMTEVMALRNEYKDLFLKKHGVKLGFMSFFTKACCHALNEV
PEVNAEIDGTDIVYKNFVHMGIAAGTPTGLVVPVIRDADAMSFADIEKAIAEKGARARDG
KLSMAEMQGGTFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPMAINGKVEIRPMMY
LALSYDHRIVDGKGAVTFLVRVKEALEDPRRLLMDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaagttcgcgtgcccaccctgggcgaatccgtgaccgaagccaccgtcgcc
acctggttcaaaaagccgggtgacgcggtcgccgcagatgaaatgctctgcgagctggaa
accgacaaagtcaccgttgaggttcccgcccctgccgccggcaccctgggtgagatcgtc
gccgccgagggcgaaaccgtcggcgtcgatgcgctgcttgccacgatcgcagaaggcggt
tctgacacagcggcagcccctgcaacatccgcaccagccgccacgaaggacgcagcaaag
ggtgatgcaggcgccgcaaccgacgtgatggtgccaacgcttggcgagtccgtgagcgag
gccactgtttccacctggttcaagaaggtcggcgacagtgtcgcgcaggacgaaatgctc
tgcgagctggaaactgataaggtctcggttgaagtgccagccccgactgccggtatcctg
accgaaatcacagctgaggaaggcagcactgtcgatgcgacggccaaactcggcgtgatc
tcaggtggcgaggcaggcgccgtaacgcccacgcccaccaaaggcgaaaccgcagatggt
gcgcaatataccacgccccccgcaggccagggcgatccggccaaggatatcgccaatgcg
ccttccgccgaaaaggcgatggctgaggctggcctctccgcggatcaggtgcaaggcagt
ggccgcgatggtcgcatcatgaaagatgacgtcgcccgcgccgtggcggctgccgcagct
gctccggcgaccagcacatcgaccccagcagcggccacacctgtgcgcgcgcccgttgct
gcagacgacgccgcccgcgaagagcgcgtgaaaatgacccgcctgcggcagaccatcgcc
aagcgtctgaaagacagtcagaacaccgcagccatgctcaccacctacaacgaggtcgat
atgaccgaggtgatggccctgcgcaacgagtacaaggatctgttcctgaaaaagcacggc
gtgaaactgggcttcatgtccttcttcaccaaggcctgctgccacgccttgaacgaggtg
cccgaggtcaacgcggagatcgacggcaccgacatcgtgtacaagaacttcgtccacatg
ggtatcgcggcaggcacgcccacgggcctggttgtcccggtgatccgagacgcagatgcg
atgtcttttgccgacattgaaaaggcgatcgccgagaaaggtgcgcgcgcccgtgacggc
aaactgtcgatggcagagatgcagggcggcactttcaccatctccaacggtggcgtctac
ggctcgctgatgtcttcgccgatcctgaacccgccgcagtccggcatcctcggcatgcac
aagatccaggaccgcccgatggccatcaatggcaaggtggagatccgcccgatgatgtat
ctggcgctgtcctacgaccaccgcatcgtcgacggcaaaggtgccgtgaccttcctcgtg
cgcgtcaaagaagcactggaagatccccgccggttgttgatggatctgtaa

DBGET integrated database retrieval system