KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c03310Help
Entry
PGA2_c03310       CDS       T02193                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA2_c03310 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA2_c03310 (sdhD)
   00650 Butanoate metabolism
    PGA2_c03310 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PGA2_c03310 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362736..363107
Genome map
AA seq 123 aa AA seqDB search
MRYLTDRKRAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYA
RPFPALVALLTIWVGMMHFKSGAQIMIEDYVHGFAGRLTIILVTCLSYAVAAVSAYALIR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacagatcgcaagcgtgccgttggcatgggtgctgcgaaatccggtaca
gcacatcactggtcgatgcaggtcagctccatcgggttgctgatcctggtgcccctgttc
gtctttacctttggctcggcgctgggcggatcttacgaagagatcaccgcctattacgcg
cgcccgtttcctgcacttgttgcactgctgaccatctgggtcggcatgatgcacttcaaa
tccggtgcgcagatcatgatcgaagactatgtccatggctttgccggtcgtctgacgatc
attctggtcacctgtctgtcttatgccgtggccgcggtcagcgcctatgcgctgatccgc
ctggcgctgtaa

DBGET integrated database retrieval system