KEGG   Phaeobacter inhibens 2.10: PGA2_c04420Help
Entry
PGA2_c04420       CDS       T02193                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGA2_c04420 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA2_c04420 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGA2_c04420 (trpB)
Enzymes [BR:pgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGA2_c04420 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
481580..482833
Genome map
AA seq 417 aa AA seqDB search
MAEDLFNSFMNGPDEQGRFGIFGGRFVSETLMPLILSLEEEYDRAKDDSSFWAEMDDLWK
NYVGRPSPLYFAERLTEHLGGAKIYLKRDELNHTGAHKINNVLGQILLARRMGKDRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVQRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFYPFLDDKSVNIIGVEAGGKGVDEKMQHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLNDIGRADYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVMKIAPDLPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEGRDSD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagatctattcaacagcttcatgaacggtcccgatgaacaggggcggtttggt
atttttggtgggcggttcgtcagcgagactttgatgccgctgatcctcagcctggaagag
gaatatgatcgcgccaaggatgactcgagtttctgggccgagatggacgatctctggaaa
aactatgttggtcgccccagtccgctctatttcgccgagcggctgactgagcatttgggc
ggcgcgaagatctatttaaaacgggatgagctgaaccataccggcgcgcataagattaac
aatgtgctgggacagatcctgctggcccgtcgcatgggtaaggatcggatcattgcggaa
accggcgcgggccagcatggcgtcgctactgccacggtctgcgccaaatttgggctgaaa
tgcgtggtctatatgggcgcgcatgatgtgcagcgtcaggcgcccaatgtcttccgtatg
cgccttctgggtgccgaagtcattccggtgacctctggccgcggcacgttgaaggatgcc
atgaacgatgccctgcgggattgggtgaccaatgtccacgacaccttctactgcatcggc
acagtggcgggaccgcatccctatccggcaatggtgcgagatttccagtcggtgatcggt
aaagaagtacgctggcagctggcagagcaggagggcgagggacgtctgccggacaccgta
atcgcagcaattggtggcgggtcaaacgccatgggcctgttctacccattcctggacgac
aagtcggtgaacatcattggtgttgaggccggtggcaaaggtgtcgatgagaagatgcag
cattgtgcctcgctcacaggtggtcgccctggcgtgctgcatggcaaccgcacctaccta
ttgcaggatgatgatggacaaattctggaaggcttttccatctctgccgggctcgattat
cccggtatcggtccggagcatgcctggttgaacgatatcggccgggccgattatgtctcc
atcactgacaaggaagcgctggaggcgttccagctatcctgcgctatggaaggcatcatt
ccggcgcttgagccgagtcatgcgctagcccatgtgatgaagatcgcgcccgacttgcct
aaggaccatatcattgtgatgaacatgtgtggccgcggcgacaaggatatctttaccgtc
gcgcgtcacctcggctttgatatgtcggacaccgaaggtcgcgacagcgactga

DBGET integrated database retrieval system