KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c04480Help
Entry
PGA2_c04480       CDS       T02193                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PGA2_c04480 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGA2_c04480 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PGA2_c04480 (trpA)
Enzymes [BR:pgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PGA2_c04480 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(487557..488420)
Genome map
AA seq 287 aa AA seqDB search
MRCPGLISAATFGTPGPTHIKGPIMTRIDAKFAELKAADKKAFVAYVMAGDPDFDTSLEL
VKGLPAAGVDVIELGLPFTDPMADGPTIQLAGQRALEAGMTLQRTLDLARAFREEDNTTP
IVMMGYYNPIYSRGVETFLKDAKEAGIDGLIVVDLPPEEDSELCLPAQQAGLNFIRLATP
TTDDKRLPRVLQNTSGFVYYVSITGITGAAEAEATNVGPEVARIKSQTDLPVIVGFGINT
PEKSQAIASVADGAVVGSAIVSQIGAGKPVGEVLSFVKSLADGAHSA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgcccgggattgatttccgccgcaacattcggcacaccggggccgacacatata
aaaggcccgatcatgacccgcattgacgccaaattcgccgaattgaaagccgcagacaaa
aaggccttcgttgcctatgtcatggcgggcgaccctgacttcgacacctcgcttgaactg
gtcaagggcctgcctgcggcgggcgtggacgtaattgagctgggcctgccctttaccgac
ccaatggccgatggtccaaccatccagttggccggccagcgcgcgctagaagcaggcatg
acgctgcagcgcaccttggatctggcccgcgccttccgcgaagaagacaataccacgccg
atcgtgatgatgggctactacaacccgatctacagccggggcgtcgaaacctttttgaag
gacgccaaagaagccggtatcgacggtctgatcgttgtggacctaccccccgaagaagac
agcgaactctgtctgcctgcgcaacaggccggtctgaattttatcaggctggccaccccg
accaccgatgacaagcgcctaccccgtgtgctgcagaacacctcaggctttgtctactat
gtgtcgatcactgggatcaccggcgccgctgaagcagaagccaccaatgtcggtcccgaa
gtggcccggatcaaatcacagacagatctgcccgtcatcgtcggcttcggcatcaataca
cccgagaaatcacaagccatcgcatccgttgcagatggcgccgtggtcggctcggcgatt
gtcagccagattggcgctggcaaacccgtgggtgaggtcctcagcttcgtcaagtctctc
gcagacggtgcgcattccgcctaa

DBGET integrated database retrieval system