KEGG   Phaeobacter gallaeciensis 2.10: PGA2_c04980Help
Entry
PGA2_c04980       CDS       T02193                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pgl  Phaeobacter gallaeciensis 2.10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGA2_c04980 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA2_c04980 (glk)
   00052 Galactose metabolism
    PGA2_c04980 (glk)
   00500 Starch and sucrose metabolism
    PGA2_c04980 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA2_c04980 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA2_c04980 (glk)
   00524 Butirosin and neomycin biosynthesis
    PGA2_c04980 (glk)
Enzymes [BR:pgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGA2_c04980 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554455..555501
Genome map
AA seq 348 aa AA seqDB search
MLALKLRRSQNCISALNTAVSRENRTFRKAEHMGSDMTVLVGDVGGSNTRLALAGPEIGV
TALQSFANDSFSSLDDVLAAYCAQPDLPPLAGACIAVAGPVYGNEYQLTNRNWQGSAADL
AQQLQLGAGARVDVINDLAALGHSLPALIPGQLSSLRAGHQRGTQALVAGIGTGFNVSLS
VDGHTAEAEMGHTSLSAPVACGLTELLGNRAGEFATNEDLFSGRGLVRYHQALHGIAAEG
GAQIVADYLADGDSPAAKTVTSWARLLGDFARELVPTYMPGQGIFFAGSVARGILGTAAC
EVFLNSFLQPATGVQSRCETTPLWLITDDAAGVSGAARFALERAGRKS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgctaaaattaaggcggtcacagaattgcatttcggctctgaatacggcagtg
tctcgcgaaaatcgaacattcagaaaggcagagcacatgggctcggatatgacagtgctg
gttggcgacgtgggcggtagcaatacccggctggccctcgccgggcctgaaatcggggtc
actgccctgcaaagctttgccaacgatagcttttctagtctggatgacgtcttggctgcc
tattgtgcgcagcctgacctgccgccgttggctggtgcctgcatcgccgttgcggggcct
gtttatggcaatgagtatcagctgaccaatcgcaactggcagggcagtgctgcggatctc
gcgcagcagttgcagcttggtgcgggcgcgcgggttgatgtgatcaacgatctggccgcg
cttggacattcgctgcccgcgctgatcccgggccagctgtcgtcgctgcgtgcagggcat
cagcggggaacgcaggcgctggtggcgggcattgggaccggttttaatgtgtcgctgtca
gtggatggtcacaccgcagaggcggagatgggccacaccagcctttcggcccctgttgca
tgtggtctgacggaactactcggcaaccgggcaggtgagttcgccaccaatgaagacctg
ttttcggggcgggggctggtgcggtatcatcaggcgctgcacggtatcgcggccgaaggt
ggcgcgcagatcgtggcggattatctcgccgatggcgacagccctgcggccaaaaccgta
accagctgggcgcggctcctgggcgattttgcccgcgagctggtgccgacctatatgccg
gggcaggggattttctttgctggcagcgtggcacgtggcattcttggcaccgccgcctgt
gaggtgttcctcaacagtttcctgcaacccgccaccggggtacagagccgctgtgaaacc
acgccgctctggctgatcaccgatgatgcagccggtgtcagcggtgcggcgcgtttcgcg
cttgaaagagctggtcgcaagagctga

DBGET integrated database retrieval system